Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

FZR1 Antibody - N-terminal region (ARP51279_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51279_P050-FITC Conjugated

ARP51279_P050-HRP Conjugated

ARP51279_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Fizzy/cell division cycle 20 related 1 (Drosophila)
NCBI Gene Id:
Protein Name:
Fizzy-related protein homolog
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-166714 from Santa Cruz Biotechnology.
Description of Target:
FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
The immunogen is a synthetic peptide directed towards the N terminal region of human FZR1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Peptide Sequence:
Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
Catalog # AAP51279 (Previous Catalog # AAPS22306)
Printable datasheet for ARP51279_P050
Sample Type Confirmation:

FZR1 is strongly supported by BioGPS gene expression data to be expressed in 721_B


Hu, R; Li, L; Li, D; Tan, W; Wan, L; Zhu, C; Zhang, Y; Zhang, C; Yao, W; Downregulation of Cdh1 signalling in spinal dorsal horn contributes to the maintenance of mechanical allodynia after nerve injury in rats. 12, (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 27184142

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...