SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP51278_P050
Price: $0.00
SKU
ARP51278_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Fzr1 (ARP51278_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN
Concentration0.5 mg/ml
Blocking PeptideFor anti-Fzr1 (ARP51278_P050) antibody is Catalog # AAP51278 (Previous Catalog # AAPS22305)
Gene SymbolFzr1
Gene Full NameFizzy/cell division cycle 20 related 1 (Drosophila)
Alias SymbolsFy, FZR, Fyr, Cdh1, FZR2, HCDH, HCDH1, AW108046
NCBI Gene Id56371
Protein NameFizzy-related protein homolog
Description of TargetFzr1 is the key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Fzr1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Uniprot IDQ9R1K5
Protein Accession #NP_062731
Nucleotide Accession #NM_019757
Protein Size (# AA)493
Molecular Weight55kDa
Protein InteractionsArhgap35; Rrm2; Ccnb1; Cdc27; Sirt2; Smurf1; Skil; Ube2c; Csf3r;
  1. What is the species homology for "Fzr1 Antibody - N-terminal region (ARP51278_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish".

  2. How long will it take to receive "Fzr1 Antibody - N-terminal region (ARP51278_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Fzr1 Antibody - N-terminal region (ARP51278_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Fzr1 Antibody - N-terminal region (ARP51278_P050)"?

    This target may also be called "Fy, FZR, Fyr, Cdh1, FZR2, HCDH, HCDH1, AW108046" in publications.

  5. What is the shipping cost for "Fzr1 Antibody - N-terminal region (ARP51278_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Fzr1 Antibody - N-terminal region (ARP51278_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Fzr1 Antibody - N-terminal region (ARP51278_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Fzr1 Antibody - N-terminal region (ARP51278_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FZR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FZR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FZR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FZR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FZR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FZR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Fzr1 Antibody - N-terminal region (ARP51278_P050)
Your Rating
We found other products you might like!