- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-FZD9 (ARP41253_T100-HRP) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FZD9 |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-FZD9 (ARP41253_T100-HRP) antibody is Catalog # AAP41253 (Previous Catalog # AAPP22608) |
Reference | Winn,R.A., (2005) J. Biol. Chem. 280 (20), 19625-19634 |
Publications | Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). WB, Zebrafish, Dog, Bovine, Guinea pig, Human, Rat, Mouse, Rabbit 20234818 |
Gene Symbol | FZD9 |
---|---|
Gene Full Name | Frizzled family receptor 9 |
Alias Symbols | FZD3, CD349 |
NCBI Gene Id | 8326 |
Protein Name | Frizzled-9 |
Description of Target | FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney. |
Uniprot ID | O00144 |
Protein Accession # | NP_003499 |
Nucleotide Accession # | NM_003508 |
Protein Size (# AA) | 591 |
Molecular Weight | 65kDa |
Protein Interactions | KRTAP10-3; SIAH1; MDFI; WNT7A; WNT1; WNT2; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish".
-
How long will it take to receive "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)" provided in?
This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)"?
This target may also be called "FZD3, CD349" in publications.
-
What is the shipping cost for "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "65kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FZD9"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FZD9"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FZD9"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FZD9"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FZD9"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FZD9"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.