FZD9 Antibody - N-terminal region : HRP (ARP41253_T100-HRP)

Catalog No: ARP41253_T100-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FZD9
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FZD9 (ARP41253_T100-HRP) antibody is Catalog # AAP41253 (Previous Catalog # AAPP22608)
• Reference: Winn,R.A., (2005) J. Biol. Chem. 280 (20), 19625-19634
• Publications:

  Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). WB, Zebrafish, Dog, Bovine, Guinea pig, Human, Rat, Mouse, Rabbit 20234818

Target Info

• Gene Symbol: FZD9
• Gene Full Name: Frizzled family receptor 9
• Alias Symbols: FZD3, CD349
• NCBI Gene Id: 8326
• Protein Name: Frizzled-9
• Description of Target: FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.
• Uniprot ID: O00144
• Protein Accession #: NP_003499
• Nucleotide Accession #: NM_003508
• Protein Size (# AA): 591
• Molecular Weight: 65kDa
• Protein Interactions: KRTAP10-3; SIAH1; MDFI; WNT7A; WNT1; WNT2;