Search Antibody, Protein, and ELISA Kit Solutions

FZD9 antibody - N-terminal region (ARP41253_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41253_T100-FITC Conjugated

ARP41253_T100-HRP Conjugated

ARP41253_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Frizzled family receptor 9
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FZD3, CD349
Replacement Item:
This antibody may replace item sc-292864 from Santa Cruz Biotechnology.
Description of Target:
FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZD9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZD9.
The immunogen is a synthetic peptide directed towards the N terminal region of human FZD9
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Zebrafish: 100%
Complete computational species homology data:
Anti-FZD9 (ARP41253_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FZD9 (ARP41253_T100) antibody is Catalog # AAP41253 (Previous Catalog # AAPP22608)
Printable datasheet for anti-FZD9 (ARP41253_T100) antibody
Target Reference:
Winn,R.A., (2005) J. Biol. Chem. 280 (20), 19625-19634

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 20234818

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...