Size:100 ul
$229.00
In Stock
SKU
ARP41253_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41253_T100-FITC Conjugated

ARP41253_T100-HRP Conjugated

ARP41253_T100-Biotin Conjugated

FZD9 Antibody - N-terminal region (ARP41253_T100)

Catalog#: ARP41253_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-292864 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FZD9
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Zebrafish: 100%
Complete computational species homology data Anti-FZD9 (ARP41253_T100)
Peptide Sequence Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FZD9 (ARP41253_T100) antibody is Catalog # AAP41253 (Previous Catalog # AAPP22608)
Datasheets/Manuals Printable datasheet for anti-FZD9 (ARP41253_T100) antibody
Target Reference Winn,R.A., (2005) J. Biol. Chem. 280 (20), 19625-19634
Publications

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 20234818

Gene Symbol FZD9
Official Gene Full Name Frizzled family receptor 9
Alias Symbols FZD3, CD349
NCBI Gene Id 8326
Protein Name Frizzled-9
Description of Target FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.
Swissprot Id O00144
Protein Accession # NP_003499
Nucleotide Accession # NM_003508
Protein Size (# AA) 591
Molecular Weight 65kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FZD9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FZD9.
Protein Interactions KRTAP10-3; SIAH1; MDFI; WNT7A; WNT1; WNT2;
  1. What is the species homology for "FZD9 Antibody - N-terminal region (ARP41253_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FZD9 Antibody - N-terminal region (ARP41253_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FZD9 Antibody - N-terminal region (ARP41253_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FZD9 Antibody - N-terminal region (ARP41253_T100)"?

    This target may also be called "FZD3, CD349" in publications.

  5. What is the shipping cost for "FZD9 Antibody - N-terminal region (ARP41253_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FZD9 Antibody - N-terminal region (ARP41253_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FZD9 Antibody - N-terminal region (ARP41253_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FZD9 Antibody - N-terminal region (ARP41253_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FZD9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FZD9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FZD9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FZD9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FZD9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FZD9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FZD9 Antibody - N-terminal region (ARP41253_T100)
Your Rating
We found other products you might like!