FZD7 Antibody - C-terminal region : Biotin (ARP41251_P050-Biotin)

Catalog No: ARP41251_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
• Peptide Sequence: Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FZD7 (ARP41251_P050-Biotin) antibody is Catalog # AAP41251 (Previous Catalog # AAPP22606)
• Reference: Vincan,E., (2005) Differentiation 73 (4), 142-153
• Publications:

  Schmuck, R. et al. Genotypic and phenotypic characterization of side population of gastric cancer cell lines. Am. J. Pathol. 178, 1792-804 (2011). IHC, Rat, Dog, Bovine, Pig, Rabbit, Human, Mouse, Guinea pig, Yeast 21435459

  Ueno, K. et al. Frizzled-7 as a potential therapeutic target in colorectal cancer. Neoplasia 10, 697-705 (2008). WB, Rat, Dog, Bovine, Pig, Rabbit, Human, Mouse, Guinea pig, Yeast 18592008

  Gökmen-Polar, Y. et al. Dual targeting of EphA2 and ER restores tamoxifen sensitivity in ER/EphA2-positive breast cancer. Breast Cancer Res. Treat. 127, 375-84 (2011). WB, IHC, Rat, Dog, Bovine, Pig, Rabbit, Human, Mouse, Guinea pig, Yeast 20602165

  Ohba, S., Lanigan, T. M. & Roessler, B. J. Leptin receptor JAK2/STAT3 signaling modulates expression of Frizzled receptors in articular chondrocytes. Osteoarthritis Cartilage 18, 1620-9 (2010). WB, IHC, Rat, Dog, Bovine, Pig, Rabbit, Human, Mouse, Guinea pig, Yeast 20868760

  McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). WB, IHC, Rat, Dog, Bovine, Pig, Rabbit, Human, Mouse, Guinea pig, Yeast 22536405

Target Info

• Gene Symbol: FZD7
• Gene Full Name: Frizzled family receptor 7
• Alias Symbols: FzE3
• NCBI Gene Id: 8324
• Protein Name: Frizzled-7
• Description of Target: FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
• Uniprot ID: O75084
• Protein Accession #: NP_003498
• Nucleotide Accession #: NM_003507
• Protein Size (# AA): 574
• Molecular Weight: 63kDa
• Protein Interactions: UBC; UBQLN4; MAGI3; UBQLN1; DLG2; DLG4; DLG1;