Size:100 ul
$319.00
In Stock
SKU
ARP41251_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41251_P050-FITC Conjugated

ARP41251_P050-HRP Conjugated

ARP41251_P050-Biotin Conjugated

FZD7 Antibody - C-terminal region (ARP41251_P050)

Catalog#: ARP41251_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-293261 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Complete computational species homology data Anti-FZD7 (ARP41251_P050)
Peptide Sequence Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FZD7 (ARP41251_P050) antibody is Catalog # AAP41251 (Previous Catalog # AAPP22606)
Datasheets/Manuals Printable datasheet for anti-FZD7 (ARP41251_P050) antibody
Target Reference Vincan,E., (2005) Differentiation 73 (4), 142-153
Publications

Gökmen-Polar, Y. et al. Dual targeting of EphA2 and ER restores tamoxifen sensitivity in ER/EphA2-positive breast cancer. Breast Cancer Res. Treat. 127, 375-84 (2011). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 20602165

McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 22536405

Ohba, S., Lanigan, T. M. & Roessler, B. J. Leptin receptor JAK2/STAT3 signaling modulates expression of Frizzled receptors in articular chondrocytes. Osteoarthritis Cartilage 18, 1620-9 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 20868760

Schmuck, R. et al. Genotypic and phenotypic characterization of side population of gastric cancer cell lines. Am. J. Pathol. 178, 1792-804 (2011). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 21435459

Ueno, K. et al. Frizzled-7 as a potential therapeutic target in colorectal cancer. Neoplasia 10, 697-705 (2008). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 18592008

Gene Symbol FZD7
Official Gene Full Name Frizzled family receptor 7
Alias Symbols FzE3
NCBI Gene Id 8324
Protein Name Frizzled-7
Description of Target FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
Swissprot Id O75084
Protein Accession # NP_003498
Nucleotide Accession # NM_003507
Protein Size (# AA) 574
Molecular Weight 63kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FZD7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FZD7.
Protein Interactions UBC; UBQLN4; MAGI3; UBQLN1; DLG2; DLG4; DLG1;
  1. What is the species homology for "FZD7 Antibody - C-terminal region (ARP41251_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast".

  2. How long will it take to receive "FZD7 Antibody - C-terminal region (ARP41251_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FZD7 Antibody - C-terminal region (ARP41251_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FZD7 Antibody - C-terminal region (ARP41251_P050)"?

    This target may also be called "FzE3" in publications.

  5. What is the shipping cost for "FZD7 Antibody - C-terminal region (ARP41251_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FZD7 Antibody - C-terminal region (ARP41251_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FZD7 Antibody - C-terminal region (ARP41251_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FZD7 Antibody - C-terminal region (ARP41251_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FZD7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FZD7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FZD7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FZD7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FZD7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FZD7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FZD7 Antibody - C-terminal region (ARP41251_P050)
Your Rating
We found other products you might like!