Search Antibody, Protein, and ELISA Kit Solutions

FZD7 antibody - C-terminal region (ARP41251_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41251_P050-FITC Conjugated

ARP41251_P050-HRP Conjugated

ARP41251_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Frizzled family receptor 7
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-293261 from Santa Cruz Biotechnology.
Description of Target:
FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZD7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZD7.
The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Complete computational species homology data:
Anti-FZD7 (ARP41251_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FZD7 (ARP41251_P050) antibody is Catalog # AAP41251 (Previous Catalog # AAPP22606)
Printable datasheet for anti-FZD7 (ARP41251_P050) antibody
Target Reference:
Vincan,E., (2005) Differentiation 73 (4), 142-153

Ueno, K. et al. Frizzled-7 as a potential therapeutic target in colorectal cancer. Neoplasia 10, 697-705 (2008). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 18592008

Gökmen-Polar, Y. et al. Dual targeting of EphA2 and ER restores tamoxifen sensitivity in ER/EphA2-positive breast cancer. Breast Cancer Res. Treat. 127, 375-84 (2011). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 20602165

Ohba, S., Lanigan, T. M. & Roessler, B. J. Leptin receptor JAK2/STAT3 signaling modulates expression of Frizzled receptors in articular chondrocytes. Osteoarthritis Cartilage 18, 1620-9 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 20868760

Schmuck, R. et al. Genotypic and phenotypic characterization of side population of gastric cancer cell lines. Am. J. Pathol. 178, 1792-804 (2011). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 21435459

McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast 22536405

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...