Search Antibody, Protein, and ELISA Kit Solutions

FZD5 Antibody - middle region (ARP41244_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41244_P050-FITC Conjugated

ARP41244_P050-HRP Conjugated

ARP41244_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 10 ug/ml.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Frizzled family receptor 5
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C2orf31, DKFZP434E2135, HFZ5, MGC129692
Replacement Item:
This antibody may replace item sc-23222 from Santa Cruz Biotechnology.
Description of Target:
Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZD5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZD5.
The immunogen is a synthetic peptide directed towards the middle region of human FZD5
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-FZD5 (ARP41244_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FZD5 (ARP41244_P050) antibody is Catalog # AAP41244 (Previous Catalog # AAPS01411)
Printable datasheet for anti-FZD5 (ARP41244_P050) antibody
Target Reference:
Carmon,K.S. (2008) Biochem. Biophys. Res. Commun. 368 (2), 285-291

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...