Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP41244_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41244_P050-FITC Conjugated

ARP41244_P050-HRP Conjugated

ARP41244_P050-Biotin Conjugated

FZD5 Antibody - middle region (ARP41244_P050)

Catalog#: ARP41244_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 10 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-23222 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FZD5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data Anti-FZD5 (ARP41244_P050)
Peptide Sequence Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FZD5 (ARP41244_P050) antibody is Catalog # AAP41244 (Previous Catalog # AAPS01411)
Datasheets/Manuals Printable datasheet for anti-FZD5 (ARP41244_P050) antibody
Target Reference Carmon,K.S. (2008) Biochem. Biophys. Res. Commun. 368 (2), 285-291
Gene Symbol FZD5
Official Gene Full Name Frizzled family receptor 5
Alias Symbols C2orf31, DKFZP434E2135, HFZ5, MGC129692
NCBI Gene Id 7855
Protein Name Frizzled-5
Description of Target Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.
Swissprot Id Q13467
Protein Accession # NP_003459
Nucleotide Accession # NM_003468
Protein Size (# AA) 585
Molecular Weight 62kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FZD5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FZD5.
Protein Interactions LRP6; UBTD1; LZTFL1; ABI3BP; RGS2; RPS6KA6; GSK3B; UBC; Ror2; GOPC; WNT7A; WNT5A;
Write Your Own Review
You're reviewing:FZD5 Antibody - middle region (ARP41244_P050)
Your Rating