Size:100 ul
$319.00
In stock
SKU
ARP41266_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41266_P050-FITC Conjugated

ARP41266_P050-HRP Conjugated

ARP41266_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135108 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FZD4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-FZD4 (ARP41266_P050)
Peptide Sequence Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FZD4 (ARP41266_P050) antibody is Catalog # AAP41266 (Previous Catalog # AAPP22621)
Datasheets/Manuals Printable datasheet for anti-FZD4 (ARP41266_P050) antibody
Target Reference Dufourcq,P., (2008) Am. J. Pathol. 172 (1), 37-49
Publications

Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). IHC, WB, Cow, Guinea Pig, Horse, Human, Mouse, Rat 23251385

McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). IHC, WB, Cow, Guinea Pig, Horse, Human, Mouse, Rat 22536405

Wang, L. et al. Impact of laminitis on the canonical Wnt signaling pathway in basal epithelial cells of the equine digital laminae. PLoS One 8, e56025 (2013). IHC, WB, Cow, Guinea Pig, Horse, Human, Mouse, Rat 23405249

Gene Symbol FZD4
Official Gene Full Name Frizzled family receptor 4
Alias Symbols EVR1, FEVR, FZD4S, Fz-4, FzE4, GPCR, MGC34390, CD344
NCBI Gene Id 8322
Protein Name Frizzled-4
Description of Target FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q9ULV1
Protein Accession # NP_036325
Nucleotide Accession # NM_012193
Protein Size (# AA) 537
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FZD4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FZD4.
Protein Interactions UBC; NDP; ZNRF3; BAG6; MAGI3; DLG2; DLG4; DVL2; DLG1; ARRB2;
Write Your Own Review
You're reviewing:FZD4 Antibody - middle region (ARP41266_P050)
Your Rating