Search Antibody, Protein, and ELISA Kit Solutions

FZD4 Antibody - middle region (ARP41266_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41266_P050-FITC Conjugated

ARP41266_P050-HRP Conjugated

ARP41266_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Frizzled family receptor 4
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
EVR1, FEVR, FZD4S, Fz-4, FzE4, GPCR, MGC34390, CD344
Replacement Item:
This antibody may replace item sc-135108 from Santa Cruz Biotechnology.
Description of Target:
FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZD4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZD4.
The immunogen is a synthetic peptide directed towards the middle region of human FZD4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-FZD4 (ARP41266_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FZD4 (ARP41266_P050) antibody is Catalog # AAP41266 (Previous Catalog # AAPP22621)
Printable datasheet for anti-FZD4 (ARP41266_P050) antibody
Target Reference:
Dufourcq,P., (2008) Am. J. Pathol. 172 (1), 37-49

Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). IHC, WB, Cow, Guinea Pig, Horse, Human, Mouse, Rat 23251385

McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). IHC, WB, Cow, Guinea Pig, Horse, Human, Mouse, Rat 22536405

Wang, L. et al. Impact of laminitis on the canonical Wnt signaling pathway in basal epithelial cells of the equine digital laminae. PLoS One 8, e56025 (2013). IHC, WB, Cow, Guinea Pig, Horse, Human, Mouse, Rat 23405249

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...