FZD4 Antibody - middle region (ARP41266_P050)

Catalog No: ARP41266_P050

Host: Rabbit
Target Name: FZD4
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: FZD4
Sample Tissue: Human RPMI 8226 Whole Cell
Antibody Dilution: 3ug/ml

Host: Rabbit
Target: FZD4
Positive control (+): Human lung (LU)
Negative control (-): 293T (2T)
Antibody concentration: 1ug/ml

Skin

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FZD4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FZD4 (ARP41266_P050) antibody is Catalog # AAP41266 (Previous Catalog # AAPP22621)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Dufourcq,P., (2008) Am. J. Pathol. 172 (1), 37-49
• Publications:

  Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). 23251385

  McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). 22536405

  Wang, L. et al. Impact of laminitis on the canonical Wnt signaling pathway in basal epithelial cells of the equine digital laminae. PLoS One 8, e56025 (2013). 23405249

Target Info

• Gene Symbol: FZD4
• Gene Full Name: Frizzled family receptor 4
• Alias Symbols: Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S
• NCBI Gene Id: 8322
• Protein Name: Frizzled-4
• Description of Target: FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9ULV1
• Protein Accession #: NP_036325
• Nucleotide Accession #: NM_012193
• Protein Size (# AA): 537
• Molecular Weight: 60 kDa
• Protein Interactions: UBC; NDP; ZNRF3; BAG6; MAGI3; DLG2; DLG4; DVL2; DLG1; ARRB2;