Loading...
Catalog No: ARP41266_P050
Price: $0.00
SKU
ARP41266_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FZD4 (ARP41266_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FZD4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Concentration0.5 mg/ml
Blocking PeptideFor anti-FZD4 (ARP41266_P050) antibody is Catalog # AAP41266 (Previous Catalog # AAPP22621)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceDufourcq,P., (2008) Am. J. Pathol. 172 (1), 37-49
Publications

Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). 23251385

McIver, S. C. et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7, e35553 (2012). 22536405

Wang, L. et al. Impact of laminitis on the canonical Wnt signaling pathway in basal epithelial cells of the equine digital laminae. PLoS One 8, e56025 (2013). 23405249

Gene SymbolFZD4
Gene Full NameFrizzled family receptor 4
Alias SymbolsFz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S
NCBI Gene Id8322
Protein NameFrizzled-4
Description of TargetFZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9ULV1
Protein Accession #NP_036325
Nucleotide Accession #NM_012193
Protein Size (# AA)537
Molecular Weight60 kDa
Protein InteractionsUBC; NDP; ZNRF3; BAG6; MAGI3; DLG2; DLG4; DVL2; DLG1; ARRB2;
  1. What is the species homology for "FZD4 Antibody - middle region (ARP41266_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse".

  2. How long will it take to receive "FZD4 Antibody - middle region (ARP41266_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FZD4 Antibody - middle region (ARP41266_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FZD4 Antibody - middle region (ARP41266_P050)"?

    This target may also be called "Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S" in publications.

  5. What is the shipping cost for "FZD4 Antibody - middle region (ARP41266_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FZD4 Antibody - middle region (ARP41266_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FZD4 Antibody - middle region (ARP41266_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FZD4 Antibody - middle region (ARP41266_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FZD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FZD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FZD4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FZD4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FZD4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FZD4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FZD4 Antibody - middle region (ARP41266_P050)
Your Rating
We found other products you might like!