FZD4 Antibody - C-terminal region (ARP89714_P050)

Catalog No: ARP89714_P050

Host: Rabbit
Target Name: FZD4
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse FZD4
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FZD4 (ARP89714_P050) antibody is Catalog # AAP89714

Target Info

• Gene Symbol: FZD4
• Gene Full Name: frizzled class receptor 4
• Alias Symbols: Fz4
• NCBI Gene Id: 14366
• Protein Name: frizzled-4
• Description of Target: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activation by Wnt5A stimulates PKC activity via a G-protein-dependent mechanism.
• Uniprot ID: Q61088
• Protein Accession #: NP_032081.3
• Nucleotide Accession #: NM_008055.4
• Protein Size (# AA): 537
• Molecular Weight: 60 kDa