Search Antibody, Protein, and ELISA Kit Solutions

FZD4 Antibody - C-terminal region (ARP89714_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
FZD4
Official Gene Full Name:
frizzled class receptor 4
NCBI Gene Id:
14366
Protein Name:
frizzled-4
Swissprot Id:
Q61088
Protein Accession #:
NP_032081.3
Nucleotide Accession #:
NM_008055.4
Alias Symbols:
Fz4
Description of Target:
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activation by Wnt5A stimulates PKC activity via a G-protein-dependent mechanism.
Protein Size (# AA):
537
Molecular Weight:
60 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZD4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZD4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse FZD4
Predicted Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FZD4 (ARP89714_P050) antibody is Catalog # AAP89714
Datasheets/Manuals:
Printable datasheet for anti-FZD4 (ARP89714_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...