Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP89714_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

FZD4 Antibody - C-terminal region (ARP89714_P050)

Catalog#: ARP89714_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse FZD4
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FZD4 (ARP89714_P050) antibody is Catalog # AAP89714
Datasheets/Manuals Printable datasheet for anti-FZD4 (ARP89714_P050) antibody
Gene Symbol FZD4
Official Gene Full Name frizzled class receptor 4
Alias Symbols Fz4
NCBI Gene Id 14366
Protein Name frizzled-4
Description of Target Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activation by Wnt5A stimulates PKC activity via a G-protein-dependent mechanism.
Swissprot Id Q61088
Protein Accession # NP_032081.3
Nucleotide Accession # NM_008055.4
Protein Size (# AA) 537
Molecular Weight 60 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FZD4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FZD4.
  1. What is the species homology for "FZD4 Antibody - C-terminal region (ARP89714_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "FZD4 Antibody - C-terminal region (ARP89714_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "FZD4 Antibody - C-terminal region (ARP89714_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FZD4 Antibody - C-terminal region (ARP89714_P050)"?

    This target may also be called "Fz4" in publications.

  5. What is the shipping cost for "FZD4 Antibody - C-terminal region (ARP89714_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FZD4 Antibody - C-terminal region (ARP89714_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FZD4 Antibody - C-terminal region (ARP89714_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FZD4 Antibody - C-terminal region (ARP89714_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FZD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FZD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FZD4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FZD4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FZD4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FZD4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FZD4 Antibody - C-terminal region (ARP89714_P050)
Your Rating