Size:100 ul
$319.00
In Stock
SKU
ARP41262_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41262_P050-FITC Conjugated

ARP41262_P050-HRP Conjugated

ARP41262_P050-Biotin Conjugated

FZD10 Antibody - N-terminal region (ARP41262_P050)

Catalog#: ARP41262_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-33510 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FZD10
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 79%
Complete computational species homology data Anti-FZD10 (ARP41262_P050)
Peptide Sequence Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FZD10 (ARP41262_P050) antibody is Catalog # AAP41262 (Previous Catalog # AAPP22617)
Datasheets/Manuals Printable datasheet for anti-FZD10 (ARP41262_P050) antibody
Target Reference Omoto,S., (2004) Ophthalmic Genet. 25 (2), 81-90
Publications

Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). WB, Cow, Dog, Horse, Human, Mouse, Pig, Zebrafish 23251385

Gene Symbol FZD10
Official Gene Full Name Frizzled family receptor 10
Alias Symbols FZ-10, FzE7, hFz10, Fz10, CD350
NCBI Gene Id 11211
Protein Name Frizzled-10
Description of Target FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
Swissprot Id Q9ULW2
Protein Accession # NP_009128
Nucleotide Accession # NM_007197
Protein Size (# AA) 581
Molecular Weight 65kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FZD10.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FZD10.
  1. What is the species homology for "FZD10 Antibody - N-terminal region (ARP41262_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Zebrafish".

  2. How long will it take to receive "FZD10 Antibody - N-terminal region (ARP41262_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FZD10 Antibody - N-terminal region (ARP41262_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FZD10 Antibody - N-terminal region (ARP41262_P050)"?

    This target may also be called "FZ-10, FzE7, hFz10, Fz10, CD350" in publications.

  5. What is the shipping cost for "FZD10 Antibody - N-terminal region (ARP41262_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FZD10 Antibody - N-terminal region (ARP41262_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FZD10 Antibody - N-terminal region (ARP41262_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FZD10 Antibody - N-terminal region (ARP41262_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FZD10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FZD10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FZD10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FZD10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FZD10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FZD10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FZD10 Antibody - N-terminal region (ARP41262_P050)
Your Rating
We found other products you might like!