Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FZD10 antibody - N-terminal region (ARP41262_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP41262_P050-FITC Conjugated

ARP41262_P050-HRP Conjugated

ARP41262_P050-Biotin Conjugated

Gene Symbol:
FZD10
NCBI Gene Id:
11211
Official Gene Full Name:
Frizzled family receptor 10
Protein Name:
Frizzled-10
Swissprot Id:
Q9ULW2
Protein Accession #:
NP_009128
Nucleotide Accession #:
NM_007197
Alias Symbols:
FZ-10, FzE7, hFz10, Fz10, CD350
Replacement Item:
This antibody may replace item sc-33510 from Santa Cruz Biotechnology.
Description of Target:
FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
Protein Size (# AA):
581
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZD10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZD10.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FZD10
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-FZD10 (ARP41262_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FZD10 (ARP41262_P050) antibody is Catalog # AAP41262 (Previous Catalog # AAPP22617)
Datasheets/Manuals:
Printable datasheet for anti-FZD10 (ARP41262_P050) antibody
Target Reference:
Omoto,S., (2004) Ophthalmic Genet. 25 (2), 81-90
Publications:

Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). WB, Cow, Dog, Horse, Human, Mouse, Pig, Zebrafish 23251385

Tell us what you think about this item!

Write A Review
    Please, wait...