Size:100 ul
$319.00
In stock
SKU
ARP41262_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41262_P050-FITC Conjugated

ARP41262_P050-HRP Conjugated

ARP41262_P050-Biotin Conjugated

FZD10 Antibody - N-terminal region (ARP41262_P050)

Catalog#: ARP41262_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-33510 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FZD10
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 79%
Complete computational species homology dataAnti-FZD10 (ARP41262_P050)
Peptide SequenceSynthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FZD10 (ARP41262_P050) antibody is Catalog # AAP41262 (Previous Catalog # AAPP22617)
Datasheets/ManualsPrintable datasheet for anti-FZD10 (ARP41262_P050) antibody
Target ReferenceOmoto,S., (2004) Ophthalmic Genet. 25 (2), 81-90
Publications

Gonzalez, P., Fernandez-Martos, C. M., Gonzalez-Fernandez, C., Arenas, E. & Rodriguez, F. J. Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats. PLoS One 7, e50793 (2012). WB, Cow, Dog, Horse, Human, Mouse, Pig, Zebrafish 23251385

Gene SymbolFZD10
Official Gene Full NameFrizzled family receptor 10
Alias SymbolsFZ-10, FzE7, hFz10, Fz10, CD350
NCBI Gene Id11211
Protein NameFrizzled-10
Description of TargetFZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
Swissprot IdQ9ULW2
Protein Accession #NP_009128
Nucleotide Accession #NM_007197
Protein Size (# AA)581
Molecular Weight65kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FZD10.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FZD10.
Write Your Own Review
You're reviewing:FZD10 Antibody - N-terminal region (ARP41262_P050)
Your Rating
Aviva Pathways
Aviva ChIP Antibodies
Free Microscope
Aviva Blast Tool