FZD10 Antibody (ARP41263_P050)

Catalog No: ARP41263_P050

Host: Rabbit
Target Name: FZD10
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 1ug/ml

ARP41263_P050 FZD10 Antibody
Sample type: COS7 cells mock transfected
Primary Ab dilution: 1:333
Secondary Ab: anti-rabbit-Cy2
Secondary Ab dilution: 1:500
Blue: DAPI
Green:FZD10
Data submitted by: Lisa Galli/Laura Burrus
San Francisco State University

ARP41263_P050 FZD10 Antibody
Sample type: COS7 cells transfected with chick FZD10
Primary Ab dilution: 1:333
Secondary Ab: anti-rabbit-Cy2
Secondary Ab dilution: 1:500
Blue: DAPI
Green:FZD10
Data submitted by: Lisa Galli/Laura Burrus
San Francisco State University

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IF
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FZD10 (ARP41263_P050) antibody is Catalog # AAP41263
• Publications:

  Anti-FZD10 Antibody ARP41263_P050 has recently been referenced in a publication:

  Galli, B. et al. GFrizzled10 mediates WNT1 and WNT3A signaling in the dorsal spinal cord of the developing chick embryo.Dev Dyn. 2014 Jun;243(6):833-43. 24599775

Target Info

• Gene Symbol: FZD10
• Gene Full Name: frizzled family receptor 10
• Alias Symbols: Fz10, FzE7, CD350, FZ-10, hFz10
• NCBI Gene Id: 11211
• Protein Name: Frizzled-10
• Description of Target: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
• Uniprot ID: Q9ULW2
• Protein Accession #: NP_009128
• Nucleotide Accession #: NM_007197
• Protein Size (# AA): 581
• Molecular Weight: 65 kDa