FXYD2 Antibody - middle region (ARP91335_P050)

Catalog No: ARP91335_P050

Host: Rabbit
Target Name: FXYD2
Sample Tissue: Mouse Skeletal Muscle lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of Mouse FXYD2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: DYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDEL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FXYD2 (ARP91335_P050) antibody is Catalog # AAP91335

Target Info

• Gene Symbol: FXYD2
• Gene Full Name: FXYD domain-containing ion transport regulator 2
• Alias Symbols: Atp1, Atp1g1
• NCBI Gene Id: 11936
• Protein Name: Sodium/potassium-transporting ATPase subunit gamma
• Description of Target: This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Multiple transcript variants have been described for this gene that are expressed in tissue-specific and developmental stage-specific patterns and encode proteins that differ at the N-terminus.
• Uniprot ID: Q04646-2
• Protein Accession #: NP_031529.2
• Nucleotide Accession #: NM_007503.3
• Protein Size (# AA): 64
• Molecular Weight: 7 kDa