FXR1 Antibody - C-terminal region (ARP40288_P050)

Catalog No: ARP40288_P050

WB Suggested Anti-FXR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FXR1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FXR1 (ARP40288_P050) antibody is Catalog # AAP40288 (Previous Catalog # AAPP10325)
• Reference: Blonden,L., (2005) Int. J. Dev. Biol. 49 (4), 437-441

Target Info

• Gene Symbol: FXR1
• Gene Full Name: Fragile X mental retardation, autosomal homolog 1
• Alias Symbols: FXR1P, MYOPMIL, MYORIBF
• NCBI Gene Id: 8087
• Protein Name: Fragile X mental retardation syndrome-related protein 1
• Description of Target: FXR1 is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit.The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P51114
• Protein Accession #: NP_005078
• Nucleotide Accession #: NM_005087
• Protein Size (# AA): 621
• Molecular Weight: 68kDa
• Protein Interactions: UBC; TOP3B; FXR2; ORC2; CAPRIN1; FMR1; LRWD1; TDRD3; UBAP2; RANBP9; SUZ12; BMI1; CSNK2A1; CAND1; COPS5; CUL3; SIRT7; ELAVL1; SUMO2; SUMO1; HDAC5; GIGYF2; LRIF1; LUC7L2; KIAA1377; CYFIP2; PRSS23; C14orf1; CRMP1; FXR1; GBP2; CYFIP1;