FXN Recombinant Protein (Mouse) (OPCA02663)

Catalog No: OPCA02663

Fxn Recombinant Protein (Mouse) (OPCA02663) in SDS-PAGE showing the molecular weight of approximately 16.4 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Host: Mouse
• Additional Information: Relevance: Promotes the biosynthesis of he and assbly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 .
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT
• Protein Sequence: LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 78-207 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Studies of human, mouse and yeast homologues indicate a mitochondrial function for frataxin.Koutnikova H., Campuzano V., Foury F., Dolle P., Cazzalini O., Koenig M.Nat. Genet. 16:345-351(1997)
• Gene Symbol: Fxn
• Gene Full Name: frataxin
• Alias Symbols: FA;FARR;Fr;frataxin, mitochondrial;Frda;Friedreich ataxia;X25.
• NCBI Gene Id: 14297
• Protein Name: Frataxin, mitochondrial
• Description of Target: Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity).
• Uniprot ID: O35943
• Protein Accession #: NP_032070.1
  
• Nucleotide Accession #: NM_008044.2
• Protein Size (# AA): Recombinant
• Molecular Weight: 16.4 kDa