Search Antibody, Protein, and ELISA Kit Solutions

FXN Antibody - C-terminal region : FITC (ARP76170_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76170_P050 Unconjugated

ARP76170_P050-HRP Conjugated

ARP76170_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
FXN
Official Gene Full Name:
frataxin
NCBI Gene Id:
2395
Protein Name:
frataxin, mitochondrial
Swissprot Id:
Q16595
Alias Symbols:
FA, X25, CyaY, FARR, FRDA
Description of Target:
This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
210
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FXN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FXN.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FRDA
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-FXN (ARP76170_P050-FITC) antibody is Catalog # AAP76170
Datasheets/Manuals:
Printable datasheet for anti-FXN (ARP76170_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...