Search Antibody, Protein, and ELISA Kit Solutions

FUT1 Antibody - C-terminal region (ARP90651_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
FUT1
Official Gene Full Name:
fucosyltransferase 1
NCBI Gene Id:
14343
Protein Name:
Galactoside 2-alpha-L-fucosyltransferase 1
Swissprot Id:
O09160
Description of Target:
This gene is one of three genes in mouse which encode a galactoside 2-L-fucosyltransferase. These genes differ in their developmental- and tissue-specific expression. The encoded type II membrane protein is anchored in the Golgi apparatus and controls the final step in the creation of alpha (1,2) fucosylated carbhohydrates by the addition of a terminal fucose in an alpha (1,2) linkage. This enzyme is required for the synthesis of the Lewis antigen as well as the H-antigen, a precursor of the A and B antigens of the ABH histo-blood group. The biological function of the fucosylated carbhohydrate products is thought to involve cell-adhesion and interactions with microorganisms. Disruption of this gene impairs development of the olfactory nerve and maturation of the glomerular layer of the main olfactory bulb. Alternative splicing results in multiple transcript variants which encode distinct isoforms
Protein Size (# AA):
376
Molecular Weight:
42 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FUT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FUT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse FUT1
Peptide Sequence:
Synthetic peptide located within the following region: ALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAA
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FUT1 (ARP90651_P050) antibody is Catalog # AAP90651
Datasheets/Manuals:
Printable datasheet for anti-FUT1 (ARP90651_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...