Size:100 ul
$319.00
In Stock
SKU
ARP53280_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53280_P050-FITC Conjugated

ARP53280_P050-HRP Conjugated

ARP53280_P050-Biotin Conjugated

FUNDC1 Antibody - N-terminal region (ARP53280_P050)

Catalog#: ARP53280_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-120340 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-FUNDC1 (ARP53280_P050)
Peptide SequenceSynthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FUNDC1 (ARP53280_P050) antibody is Catalog # AAP53280 (Previous Catalog # AAPP30762)
Datasheets/ManualsPrintable datasheet for anti-FUNDC1 (ARP53280_P050) antibody
Target ReferenceRoss,M.T., (2005) Nature 434 (7031), 325-337
Publications

Huang, M. L.-H. et al. Molecular and functional alterations in a mouse cardiac model of Friedreich ataxia: activation of the integrated stress response, eIF2-alpha phosphorylation, and the induction of downstream targets. Am. J. Pathol. 183, 745-57 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23886890

Zhang, Y; Yin, J; Zhang, L; Qi, CC; Ma, ZL; Gao, LP; Wang, DG; Jing, YH; Spermidine preconditioning ameliorates laurate-induced brain injury by maintaining mitochondrial stability. 39, 248-258 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28112032

Gene SymbolFUNDC1
Official Gene Full NameFUN14 domain containing 1
Alias SymbolsMGC51029
NCBI Gene Id139341
Protein NameFUN14 domain-containing protein 1
Description of TargetFUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
Swissprot IdQ8IVP5
Protein Accession #NP_776155
Nucleotide Accession #NM_173794
Protein Size (# AA)155
Molecular Weight17kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FUNDC1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FUNDC1.
Protein InteractionsSLC25A46; MAP1LC3A; MAP1LC3B; SENP2; SH3GLB1; MTERF3; GABARAPL1; GABARAPL2; YES1; TUFM; SNX1; EHHADH; CTBP2; CTBP1; UBC;
Write Your Own Review
You're reviewing:FUNDC1 Antibody - N-terminal region (ARP53280_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva Validation Data
Free Microscope