Search Antibody, Protein, and ELISA Kit Solutions

FUNDC1 Antibody - N-terminal region (ARP53280_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53280_P050-FITC Conjugated

ARP53280_P050-HRP Conjugated

ARP53280_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
FUN14 domain containing 1
NCBI Gene Id:
Protein Name:
FUN14 domain-containing protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-120340 from Santa Cruz Biotechnology.
Description of Target:
FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FUNDC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FUNDC1.
The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-FUNDC1 (ARP53280_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FUNDC1 (ARP53280_P050) antibody is Catalog # AAP53280 (Previous Catalog # AAPP30762)
Printable datasheet for anti-FUNDC1 (ARP53280_P050) antibody
Target Reference:
Ross,M.T., (2005) Nature 434 (7031), 325-337

Huang, M. L.-H. et al. Molecular and functional alterations in a mouse cardiac model of Friedreich ataxia: activation of the integrated stress response, eIF2-alpha phosphorylation, and the induction of downstream targets. Am. J. Pathol. 183, 745-57 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23886890

Zhang, Y; Yin, J; Zhang, L; Qi, CC; Ma, ZL; Gao, LP; Wang, DG; Jing, YH; Spermidine preconditioning ameliorates laurate-induced brain injury by maintaining mitochondrial stability. 39, 248-258 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28112032

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...