Size:100 ul
$319.00
In Stock
SKU
ARP53280_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53280_P050-FITC Conjugated

ARP53280_P050-HRP Conjugated

ARP53280_P050-Biotin Conjugated

FUNDC1 Antibody - N-terminal region (ARP53280_P050)

Catalog#: ARP53280_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-120340 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-FUNDC1 (ARP53280_P050)
Peptide Sequence Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FUNDC1 (ARP53280_P050) antibody is Catalog # AAP53280 (Previous Catalog # AAPP30762)
Datasheets/Manuals Printable datasheet for anti-FUNDC1 (ARP53280_P050) antibody
Target Reference Ross,M.T., (2005) Nature 434 (7031), 325-337
Publications

Huang, M. L.-H. et al. Molecular and functional alterations in a mouse cardiac model of Friedreich ataxia: activation of the integrated stress response, eIF2-alpha phosphorylation, and the induction of downstream targets. Am. J. Pathol. 183, 745-57 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23886890

Zhang, Y; Yin, J; Zhang, L; Qi, CC; Ma, ZL; Gao, LP; Wang, DG; Jing, YH; Spermidine preconditioning ameliorates laurate-induced brain injury by maintaining mitochondrial stability. 39, 248-258 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28112032

Gene Symbol FUNDC1
Official Gene Full Name FUN14 domain containing 1
Alias Symbols MGC51029
NCBI Gene Id 139341
Protein Name FUN14 domain-containing protein 1
Description of Target FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
Swissprot Id Q8IVP5
Protein Accession # NP_776155
Nucleotide Accession # NM_173794
Protein Size (# AA) 155
Molecular Weight 17kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FUNDC1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FUNDC1.
Protein Interactions SLC25A46; MAP1LC3A; MAP1LC3B; SENP2; SH3GLB1; MTERF3; GABARAPL1; GABARAPL2; YES1; TUFM; SNX1; EHHADH; CTBP2; CTBP1; UBC;
  1. What is the species homology for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FUNDC1 Antibody - N-terminal region (ARP53280_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    This target may also be called "MGC51029" in publications.

  5. What is the shipping cost for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FUNDC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FUNDC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FUNDC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FUNDC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FUNDC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FUNDC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FUNDC1 Antibody - N-terminal region (ARP53280_P050)
Your Rating
We found other products you might like!