SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP53280_P050
Price: $0.00
SKU
ARP53280_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FUNDC1 (ARP53280_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FUNDC1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
Concentration0.5 mg/ml
Blocking PeptideFor anti-FUNDC1 (ARP53280_P050) antibody is Catalog # AAP53280 (Previous Catalog # AAPP30762)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceRoss,M.T., (2005) Nature 434 (7031), 325-337
Publications

BNIP3L/Nix-induced mitochondrial fission, mitophagy, and impaired myocyte glucose uptake are abrogated by PRKA/PKA phosphorylation. Autophagy. , 42370 (2020). 33044904

FUNDC1 regulates mitochondrial dynamics at the ER-mitochondrial contact site under hypoxic conditions. EMBO J. 35, 1368-84 (2016). 27145933

Huang, M. L.-H. et al. Molecular and functional alterations in a mouse cardiac model of Friedreich ataxia: activation of the integrated stress response, eIF2a phosphorylation, and the induction of downstream targets. Am. J. Pathol. 183, 745-57 (2013). 23886890

Mark A Lampert, et al. BNIP3L/NIX and FUNDC1-mediated mitophagy is required for mitochondrial network remodeling during cardiac progenitor cell differentiation. 1182-1198 (2019). 30741592

MicroRNA-137 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX. J Biol Chem. 289, 10691-701 (2014). 24573672

Phosphorylation of ULK1 by AMPK regulates translocation of ULK1 to mitochondria and mitophagy. FEBS Lett. 589, 1847-54 (2015). 25980607

Spermidine preconditioning ameliorates laurate-induced brain injury by maintaining mitochondrial stability. Neurol. Res. 39, 248-258 (2017). 28112032

Structural basis for the phosphorylation of FUNDC1 LIR as a molecular switch of mitophagy. Autophagy. 12, 2363-2373 (2016). 27653272

STX17 dynamically regulated by Fis1 induces mitophagy via hierarchical macroautophagic mechanism. Nat Commun. 10, 2059 (2019). 31053718

Description
Gene SymbolFUNDC1
Gene Full NameFUN14 domain containing 1
Alias SymbolsMGC51029
NCBI Gene Id139341
Protein NameFUN14 domain-containing protein 1
Description of TargetFUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
Uniprot IDQ8IVP5
Protein Accession #NP_776155
Nucleotide Accession #NM_173794
Protein Size (# AA)155
Molecular Weight17 kDa
Protein InteractionsSLC25A46; MAP1LC3A; MAP1LC3B; SENP2; SH3GLB1; MTERF3; GABARAPL1; GABARAPL2; YES1; TUFM; SNX1; EHHADH; CTBP2; CTBP1; UBC;
  1. What is the species homology for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FUNDC1 Antibody - N-terminal region (ARP53280_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    This target may also be called "MGC51029" in publications.

  5. What is the shipping cost for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FUNDC1 Antibody - N-terminal region (ARP53280_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FUNDC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FUNDC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FUNDC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FUNDC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FUNDC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FUNDC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FUNDC1 Antibody - N-terminal region (ARP53280_P050)
Your Rating
We found other products you might like!