Search Antibody, Protein, and ELISA Kit Solutions

FUBP1 Antibody - N-terminal region (ARP37732_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37732_T100-FITC Conjugated

ARP37732_T100-HRP Conjugated

ARP37732_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-11098 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human FUBP1
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-FUBP1 (ARP37732_T100)
Peptide Sequence:
Synthetic peptide located within the following region: IGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FUBP1 (ARP37732_T100) antibody is Catalog # AAP37732 (Previous Catalog # AAPP08814)
Printable datasheet for anti-FUBP1 (ARP37732_T100) antibody
Sample Type Confirmation:

FUBP1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Duncan,R., et al., (1994) Genes Dev. 8 (4), 465-480

Zheng, W; Shen, F; Hu, R; Roy, B; Yang, J; Wang, Q; Zhang, F; King, JC; Sergi, C; Liu, SM; Cordat, E; Tang, J; Cao, Y; Ali, D; Chen, XZ; Far Upstream Element-Binding Protein 1 Binds the 3' Untranslated Region of PKD2 and Suppresses Its Translation. 27, 2645-57 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26839368

Gene Symbol:
Official Gene Full Name:
Far upstream element (FUSE) binding protein 1
Alias Symbols:
NCBI Gene Id:
Protein Name:
Far upstream element-binding protein 1
Description of Target:
Far upstream element-binding protein activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. FUBP activity may be regulated by alternative splicing, translation efficiency, and posttranslational modification.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FUBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FUBP1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...