Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37732_T100-FITC Conjugated

ARP37732_T100-HRP Conjugated

ARP37732_T100-Biotin Conjugated

FUBP1 Antibody - N-terminal region (ARP37732_T100)

Catalog#: ARP37732_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11098 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FUBP1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-FUBP1 (ARP37732_T100)
Peptide Sequence Synthetic peptide located within the following region: IGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FUBP1 (ARP37732_T100) antibody is Catalog # AAP37732 (Previous Catalog # AAPP08814)
Datasheets/Manuals Printable datasheet for anti-FUBP1 (ARP37732_T100) antibody
Sample Type Confirmation

FUBP1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Duncan,R., et al., (1994) Genes Dev. 8 (4), 465-480

Zheng, W; Shen, F; Hu, R; Roy, B; Yang, J; Wang, Q; Zhang, F; King, JC; Sergi, C; Liu, SM; Cordat, E; Tang, J; Cao, Y; Ali, D; Chen, XZ; Far Upstream Element-Binding Protein 1 Binds the 3' Untranslated Region of PKD2 and Suppresses Its Translation. 27, 2645-57 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26839368

Gene Symbol FUBP1
Official Gene Full Name Far upstream element (FUSE) binding protein 1
Alias Symbols FBP, FUBP
NCBI Gene Id 8880
Protein Name Far upstream element-binding protein 1
Description of Target Far upstream element-binding protein activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. FUBP activity may be regulated by alternative splicing, translation efficiency, and posttranslational modification.
Swissprot Id Q96AE4
Protein Accession # NP_003893
Nucleotide Accession # NM_003902
Protein Size (# AA) 644
Molecular Weight 68kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FUBP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FUBP1.
  1. What is the species homology for "FUBP1 Antibody - N-terminal region (ARP37732_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FUBP1 Antibody - N-terminal region (ARP37732_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FUBP1 Antibody - N-terminal region (ARP37732_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FUBP1 Antibody - N-terminal region (ARP37732_T100)"?

    This target may also be called "FBP, FUBP" in publications.

  5. What is the shipping cost for "FUBP1 Antibody - N-terminal region (ARP37732_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FUBP1 Antibody - N-terminal region (ARP37732_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FUBP1 Antibody - N-terminal region (ARP37732_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FUBP1 Antibody - N-terminal region (ARP37732_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FUBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FUBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FUBP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FUBP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FUBP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FUBP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FUBP1 Antibody - N-terminal region (ARP37732_T100)
Your Rating
We found other products you might like!