Size:100 ul
$229.00
In Stock
SKU
ARP37732_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37732_T100-FITC Conjugated

ARP37732_T100-HRP Conjugated

ARP37732_T100-Biotin Conjugated

FUBP1 Antibody - N-terminal region (ARP37732_T100)

Catalog#: ARP37732_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-11098 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FUBP1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-FUBP1 (ARP37732_T100)
Peptide SequenceSynthetic peptide located within the following region: IGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FUBP1 (ARP37732_T100) antibody is Catalog # AAP37732 (Previous Catalog # AAPP08814)
Datasheets/ManualsPrintable datasheet for anti-FUBP1 (ARP37732_T100) antibody
Sample Type Confirmation

FUBP1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceDuncan,R., et al., (1994) Genes Dev. 8 (4), 465-480
Publications

Zheng, W; Shen, F; Hu, R; Roy, B; Yang, J; Wang, Q; Zhang, F; King, JC; Sergi, C; Liu, SM; Cordat, E; Tang, J; Cao, Y; Ali, D; Chen, XZ; Far Upstream Element-Binding Protein 1 Binds the 3' Untranslated Region of PKD2 and Suppresses Its Translation. 27, 2645-57 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26839368

Gene SymbolFUBP1
Official Gene Full NameFar upstream element (FUSE) binding protein 1
Alias SymbolsFBP, FUBP
NCBI Gene Id8880
Protein NameFar upstream element-binding protein 1
Description of TargetFar upstream element-binding protein activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. FUBP activity may be regulated by alternative splicing, translation efficiency, and posttranslational modification.
Swissprot IdQ96AE4
Protein Accession #NP_003893
Nucleotide Accession #NM_003902
Protein Size (# AA)644
Molecular Weight68kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FUBP1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FUBP1.
Protein InteractionsUBC; MDM2; EED; DDX19A; NSUN2; PLD3; ARPC2; ACTR2; ACTR3; ARPC4; HIST1H2BO; SH3GL1; RPA1; PPP5C; LGALS1; CNN2; BAG1; ACO1; AARSD1; GRPEL1; NIF3L1; RPRD1B; CD81; ITGA4; FN1; ATF2; AIMP2; VCAM1; DHX36; MRPL32; MRPL38; MRPL41; MRPL2; CERS2; MRPL42; MRPL46; P
Write Your Own Review
You're reviewing:FUBP1 Antibody - N-terminal region (ARP37732_T100)
Your Rating
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva Tissue Tool
Aviva Pathways