Search Antibody, Protein, and ELISA Kit Solutions

FUBP1 Antibody - middle region (ARP35704_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35704_P050-FITC Conjugated

ARP35704_P050-HRP Conjugated

ARP35704_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Far upstream element (FUSE) binding protein 1
NCBI Gene Id:
Protein Name:
Far upstream element-binding protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-11098 from Santa Cruz Biotechnology.
Description of Target:
FUBP1 is a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase.This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FUBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FUBP1.
The immunogen is a synthetic peptide directed towards the middle region of human FUBP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-FUBP1 (ARP35704_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FUBP1 (ARP35704_P050) antibody is Catalog # AAP35704 (Previous Catalog # AAPP23552)
Printable datasheet for anti-FUBP1 (ARP35704_P050) antibody
Sample Type Confirmation:

FUBP1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Milosevic, J., Bulau, P., Mortz, E. & Eickelberg, O. Subcellular fractionation of TGF-beta1-stimulated lung epithelial cells: a novel proteomic approach for identifying signaling intermediates. Proteomics 9, 1230-40 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 19253281

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...