Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP35704_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35704_P050-FITC Conjugated

ARP35704_P050-HRP Conjugated

ARP35704_P050-Biotin Conjugated

FUBP1 Antibody - middle region (ARP35704_P050)

Catalog#: ARP35704_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11098 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FUBP1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-FUBP1 (ARP35704_P050)
Peptide Sequence Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FUBP1 (ARP35704_P050) antibody is Catalog # AAP35704 (Previous Catalog # AAPP23552)
Datasheets/Manuals Printable datasheet for anti-FUBP1 (ARP35704_P050) antibody
Sample Type Confirmation

FUBP1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Publications

Milosevic, J., Bulau, P., Mortz, E. & Eickelberg, O. Subcellular fractionation of TGF-beta1-stimulated lung epithelial cells: a novel proteomic approach for identifying signaling intermediates. Proteomics 9, 1230-40 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 19253281

Gene Symbol FUBP1
Official Gene Full Name Far upstream element (FUSE) binding protein 1
Alias Symbols FBP, FUBP
NCBI Gene Id 8880
Protein Name Far upstream element-binding protein 1
Description of Target FUBP1 is a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase.This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q96AE4
Protein Accession # NP_003893
Nucleotide Accession # NM_003902
Protein Size (# AA) 644
Molecular Weight 67kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FUBP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FUBP1.
Protein Interactions UBC; MDM2; EED; DDX19A; NSUN2; PLD3; ARPC2; ACTR2; ACTR3; ARPC4; HIST1H2BO; SH3GL1; RPA1; PPP5C; LGALS1; CNN2; BAG1; ACO1; AARSD1; GRPEL1; NIF3L1; RPRD1B; CD81; ITGA4; FN1; ATF2; AIMP2; VCAM1; DHX36; MRPL32; MRPL38; MRPL41; MRPL2; CERS2; MRPL42; MRPL46; P
  1. What is the species homology for "FUBP1 Antibody - middle region (ARP35704_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "FUBP1 Antibody - middle region (ARP35704_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FUBP1 Antibody - middle region (ARP35704_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FUBP1 Antibody - middle region (ARP35704_P050)"?

    This target may also be called "FBP, FUBP" in publications.

  5. What is the shipping cost for "FUBP1 Antibody - middle region (ARP35704_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FUBP1 Antibody - middle region (ARP35704_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FUBP1 Antibody - middle region (ARP35704_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FUBP1 Antibody - middle region (ARP35704_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FUBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FUBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FUBP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FUBP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FUBP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FUBP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FUBP1 Antibody - middle region (ARP35704_P050)
Your Rating