Search Antibody, Protein, and ELISA Kit Solutions

FTH1 antibody - middle region (ARP54620_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54620_P050-FITC Conjugated

ARP54620_P050-HRP Conjugated

ARP54620_P050-Biotin Conjugated

Gene Symbol:
FTH1
NCBI Gene Id:
2495
Official Gene Full Name:
Ferritin, heavy polypeptide 1
Protein Name:
Ferritin heavy chain
Swissprot Id:
P02794
Protein Accession #:
NP_002023
Nucleotide Accession #:
NM_002032
Alias Symbols:
FTH, FTHL6, MGC104426, PIG15, PLIF, FHC
Replacement Item:
This antibody may replace item sc-135667 from Santa Cruz Biotechnology.
Description of Target:
FTH1 is the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
183
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FTH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FTH1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FTH1
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-FTH1 (ARP54620_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SDCBP; FTL; FTH1; WDYHV1; CEP57; AURKB; TP53; AURKA; ASB15; ASB16; SUPT16H; SET; MAPK9; MAX; IGSF8; TICAM2; HCVgp1; PIAS4; CDC16; YWHAE; SOX5; MYL3; LBP; KPNA2; GRB2; DAXX; CSNK2B; CDC25A; ATP6V1B1; CD99; SPP1; TRAF4; SUMO2; UBC; Cep55; Trim28; NR1I3; NR3
Blocking Peptide:
For anti-FTH1 (ARP54620_P050) antibody is Catalog # AAP54620 (Previous Catalog # AAPP31411)
Datasheets/Manuals:
Printable datasheet for anti-FTH1 (ARP54620_P050) antibody
Sample Type Confirmation:

FTH1 is supported by BioGPS gene expression data to be expressed in HeLa

Additional Information:
IHC Information: Paraffin embedded human kidney tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Sammarco,M.C., (2008) J. Biol. Chem. 283 (8), 4578-4587
Publications:

Potrykus, J. et al. Fungal Iron Availability during Deep Seated Candidiasis Is Defined by a Complex Interplay Involving Systemic and Local Events. PLoS Pathog. 9, e1003676 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 24146619

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...