Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54620_P050-FITC Conjugated

ARP54620_P050-HRP Conjugated

ARP54620_P050-Biotin Conjugated

FTH1 Antibody - middle region (ARP54620_P050)

Catalog#: ARP54620_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded human kidney tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135667 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FTH1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data Anti-FTH1 (ARP54620_P050)
Peptide Sequence Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FTH1 (ARP54620_P050) antibody is Catalog # AAP54620 (Previous Catalog # AAPP31411)
Datasheets/Manuals Printable datasheet for anti-FTH1 (ARP54620_P050) antibody
Sample Type Confirmation

FTH1 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference Sammarco,M.C., (2008) J. Biol. Chem. 283 (8), 4578-4587

Potrykus, J. et al. Fungal Iron Availability during Deep Seated Candidiasis Is Defined by a Complex Interplay Involving Systemic and Local Events. PLoS Pathog. 9, e1003676 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 24146619

Gene Symbol FTH1
Official Gene Full Name Ferritin, heavy polypeptide 1
Alias Symbols FTH, FTHL6, MGC104426, PIG15, PLIF, FHC
NCBI Gene Id 2495
Protein Name Ferritin heavy chain
Description of Target FTH1 is the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P02794
Protein Accession # NP_002023
Nucleotide Accession # NM_002032
Protein Size (# AA) 183
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FTH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FTH1.
Protein Interactions SDCBP; FTL; FTH1; WDYHV1; CEP57; AURKB; TP53; AURKA; ASB15; ASB16; SUPT16H; SET; MAPK9; MAX; IGSF8; TICAM2; HCVgp1; PIAS4; CDC16; YWHAE; SOX5; MYL3; LBP; KPNA2; GRB2; DAXX; CSNK2B; CDC25A; ATP6V1B1; CD99; SPP1; TRAF4; SUMO2; UBC; Cep55; Trim28; NR1I3; NR3
  1. What is the species homology for "FTH1 Antibody - middle region (ARP54620_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "FTH1 Antibody - middle region (ARP54620_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FTH1 Antibody - middle region (ARP54620_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FTH1 Antibody - middle region (ARP54620_P050)"?

    This target may also be called "FTH, FTHL6, MGC104426, PIG15, PLIF, FHC" in publications.

  5. What is the shipping cost for "FTH1 Antibody - middle region (ARP54620_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FTH1 Antibody - middle region (ARP54620_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FTH1 Antibody - middle region (ARP54620_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FTH1 Antibody - middle region (ARP54620_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FTH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FTH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FTH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FTH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FTH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FTH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FTH1 Antibody - middle region (ARP54620_P050)
Your Rating
We found other products you might like!