Size:100 ul
$289.00
In Stock
SKU
ARP41577_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41577_P050 Unconjugated

ARP41577_P050-HRP Conjugated

ARP41577_P050-Biotin Conjugated

FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)

Catalog#: ARP41577_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationIHC, WB
Additional InformationIHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-120329 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FTCD
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Complete computational species homology dataAnti-FTCD (ARP41577_P050)
Peptide SequenceSynthetic peptide located within the following region: KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK
Concentration0.5 mg/ml
Blocking PeptideFor anti-FTCD (ARP41577_P050-FITC) antibody is Catalog # AAP41577 (Previous Catalog # AAPP24262)
Datasheets/ManualsPrintable datasheet for anti-FTCD (ARP41577_P050-FITC) antibody
Target ReferenceHillman,R.T., Genome Biol. 5 (2), R8 (2004)
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Pig, Rat, Mouse, Bovine, Dog, Horse, Guinea pig, Zebrafish, Rabbit 23103828

Gene SymbolFTCD
Official Gene Full NameFormiminotransferase cyclodeaminase
Alias SymbolsLCHC1
NCBI Gene Id10841
Protein NameFormimidoyltransferase-cyclodeaminase
Description of TargetFTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM].
Swissprot IdO95954
Protein Accession #NP_006648
Nucleotide Accession #NM_006657
Protein Size (# AA)549
Molecular Weight59kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FTCD.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FTCD.
Protein InteractionsCCDC155; MED4; TNKS2; GRB14;
  1. What is the species homology for "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)"?

    This target may also be called "LCHC1" in publications.

  5. What is the shipping cost for "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FTCD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FTCD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FTCD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FTCD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FTCD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FTCD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FTCD Antibody - middle region : FITC (ARP41577_P050-FITC)
Your Rating
Aviva ChIP Antibodies
Aviva Blast Tool
Aviva Travel Grant
Aviva Tissue Tool