Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

FTCD Antibody - middle region (ARP41577_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41577_P050-FITC Conjugated

ARP41577_P050-HRP Conjugated

ARP41577_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Formiminotransferase cyclodeaminase
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-120329 from Santa Cruz Biotechnology.
Description of Target:
FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FTCD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FTCD.
The immunogen is a synthetic peptide directed towards the middle region of human FTCD
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-FTCD (ARP41577_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCDC155; MED4; TNKS2; GRB14;
Blocking Peptide:
For anti-FTCD (ARP41577_P050) antibody is Catalog # AAP41577 (Previous Catalog # AAPP24262)
Printable datasheet for anti-FTCD (ARP41577_P050) antibody
Additional Information:
IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Hillman,R.T., Genome Biol. 5 (2), R8 (2004)

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23103828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...