Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41577_P050-FITC Conjugated

ARP41577_P050-HRP Conjugated

ARP41577_P050-Biotin Conjugated

FTCD Antibody - middle region (ARP41577_P050)

Catalog#: ARP41577_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-120329 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FTCD
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-FTCD (ARP41577_P050)
Peptide Sequence Synthetic peptide located within the following region: KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FTCD (ARP41577_P050) antibody is Catalog # AAP41577 (Previous Catalog # AAPP24262)
Datasheets/Manuals Printable datasheet for anti-FTCD (ARP41577_P050) antibody
Target Reference Hillman,R.T., Genome Biol. 5 (2), R8 (2004)

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23103828

Gene Symbol FTCD
Official Gene Full Name Formiminotransferase cyclodeaminase
Alias Symbols LCHC1
NCBI Gene Id 10841
Protein Name Formimidoyltransferase-cyclodeaminase
Description of Target FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.[supplied by OMIM].
Swissprot Id O95954
Protein Accession # NP_006648
Nucleotide Accession # NM_006657
Protein Size (# AA) 549
Molecular Weight 59kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FTCD.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FTCD.
Protein Interactions CCDC155; MED4; TNKS2; GRB14;
Write Your Own Review
You're reviewing:FTCD Antibody - middle region (ARP41577_P050)
Your Rating