Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OPPA01020 (Formerly GWB-500194)
Size:2UG
Price: $75.00
SKU
OPPA01020
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FSH Protein (OPPA01020)

Datasheets/ManualsPrintable datasheet for OPPA01020
Product Info
Predicted Species ReactivityHuman
Product FormatLyophilized PBS
Physical Appearance: Sterile filtered white freeze-dried powder
HostChinese Hamster Ovarian Cells (CHO)
Reconstitution and StorageIt is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18M-omega-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution FSH should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
PurificationFSH human recombinant is purified by proprietary chromatographic techniques.
Concentration1 mg/ml (prior to lyophilization)
PurityGreater than 95.0% as determined by SDS-PAGE.
Biological ActivityThe ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Peptide SequenceFSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS.
FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.
Gene SymbolFSH
Alias SymbolsHH24
NCBI Gene Id2488
Protein NameFollitropin subunit beta
Description of TargetFollicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction: In women, in the ovary FSH stimulates the growth of immature Graafian follicles to maturation. As the follicle grows it releases inhibin, which shuts off the FSH production. In men, FSH enhances the production of androgen-binding protein by the Sertoli cells of the testes and is critical for spermatogenesis. In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells. With the concomitant rise in inhibin B FSH levels then decline in the late follicular phase. This seems to be critical in selecting only the most advanced follicle to proceed to ovulation. At the end of the luteal phase, there is a slight rise in FSH that seems to be of importance to start the next ovulatory cycle. Like its partner, LH, FSH release at the pituitary gland is controlled by pulses of gonadotropin-releasing hormone (GnRH). Those pulses, in turn, are subject to the estrogen feed-back from the gonads. FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Ala25-Ser116) and human FSH-beta chain (Asn19-Glu129) (Accession # P01225).
Uniprot IDP01225
Protein Accession #NP_000501.1
Protein Size (# AA)Recombinant
Molecular Weight38 kDa
Write Your Own Review
You're reviewing:FSH Protein (OPPA01020)
Your Rating
We found other products you might like!