Search Antibody, Protein, and ELISA Kit Solutions

FRG1 Antibody - N-terminal region : FITC (ARP76171_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76171_P050 Unconjugated

ARP76171_P050-HRP Conjugated

ARP76171_P050-Biotin Conjugated

Gene Symbol:
FRG1
NCBI Gene Id:
2483
Swissprot Id:
Q14331
Protein Accession #:
NP_004468
Alias Symbols:
FRG1,
Replacement Item:
This antibody may replace item sc-101050 from Santa Cruz Biotechnology.
Description of Target:
This gene maps to a location 100 kb centromeric of the repeat units on chromosome 4q35 which are deleted in facioscapulohumeral muscular dystrophy (FSHD). It is evolutionarily conserved and has related sequences on multiple human chromosomes but DNA sequence analysis did not reveal any homology to known genes. In vivo studies demonstrate the encoded protein is localized to the nucleolus.
Protein Size (# AA):
258
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FRG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FRG1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FRG1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-FRG1 (ARP76171_P050-FITC) antibody is Catalog # AAP76171
Datasheets/Manuals:
Printable datasheet for anti-FRG1 (ARP76171_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...