FPGS Antibody - middle region : FITC (ARP63438_P050-FITC)

Catalog No: ARP63438_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FPGS (ARP63438_P050-FITC) antibody is Catalog # AAP63438

Target Info

• Gene Symbol: FPGS
• Gene Full Name: Folylpolyglutamate synthase
• Alias Symbols: -
• NCBI Gene Id: 2356
• Protein Name: Folylpolyglutamate synthase, mitochondrial
• Description of Target: This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms.
• Uniprot ID: Q5JU19
• Protein Accession #: NP_001018088
• Nucleotide Accession #: NM_001018078
• Protein Size (# AA): 537
• Molecular Weight: 59kDa
• Protein Interactions: UBC;