Search Antibody, Protein, and ELISA Kit Solutions

FPGS Antibody - middle region (ARP63438_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63438_P050-FITC Conjugated

ARP63438_P050-HRP Conjugated

ARP63438_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Folylpolyglutamate synthase
NCBI Gene Id:
Protein Name:
Folylpolyglutamate synthase, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-145232 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FPGS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FPGS.
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-FPGS (ARP63438_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FPGS (ARP63438_P050) antibody is Catalog # AAP63438
Printable datasheet for anti-FPGS (ARP63438_P050) antibody

Fukuda, S; Oguri, T; Kunii, E; Sone, K; Uemura, T; Takakuwa, O; Maeno, K; Kanemitsu, Y; Ohkubo, H; Takemura, M; Ito, Y; Niimi, A; A folylpoly-γ-glutamate synthase single nucleotide polymorphism associated with response to pemetrexed treatment combined with platinum for non-small cell lung cancer. 102, 15-20 (2016). WB, IHC, Human 27987582

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...