Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP63438_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63438_P050-FITC Conjugated

ARP63438_P050-HRP Conjugated

ARP63438_P050-Biotin Conjugated

FPGS Antibody - middle region (ARP63438_P050)

Catalog#: ARP63438_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-145232 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-FPGS (ARP63438_P050)
Peptide Sequence Synthetic peptide located within the following region: CWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FPGS (ARP63438_P050) antibody is Catalog # AAP63438
Datasheets/Manuals Printable datasheet for anti-FPGS (ARP63438_P050) antibody
Publications

Fukuda, S; Oguri, T; Kunii, E; Sone, K; Uemura, T; Takakuwa, O; Maeno, K; Kanemitsu, Y; Ohkubo, H; Takemura, M; Ito, Y; Niimi, A; A folylpoly-γ-glutamate synthase single nucleotide polymorphism associated with response to pemetrexed treatment combined with platinum for non-small cell lung cancer. 102, 15-20 (2016). WB, IHC, Human 27987582

Gene Symbol FPGS
Official Gene Full Name Folylpolyglutamate synthase
Alias Symbols -
NCBI Gene Id 2356
Protein Name Folylpolyglutamate synthase, mitochondrial
Description of Target This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms.
Swissprot Id Q5JU19
Protein Accession # NP_001018088
Nucleotide Accession # NM_001018078
Protein Size (# AA) 537
Molecular Weight 59kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FPGS.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FPGS.
Protein Interactions UBC;
  1. What is the species homology for "FPGS Antibody - middle region (ARP63438_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "FPGS Antibody - middle region (ARP63438_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FPGS Antibody - middle region (ARP63438_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FPGS Antibody - middle region (ARP63438_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "FPGS Antibody - middle region (ARP63438_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FPGS Antibody - middle region (ARP63438_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FPGS Antibody - middle region (ARP63438_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FPGS Antibody - middle region (ARP63438_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FPGS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FPGS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FPGS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FPGS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FPGS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FPGS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FPGS Antibody - middle region (ARP63438_P050)
Your Rating
We found other products you might like!