Size:100 ul
$249.00
In Stock
SKU
ARP32743_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32743_T100-FITC Conjugated

ARP32743_T100-HRP Conjugated

ARP32743_T100-Biotin Conjugated

FOXP3 Antibody - N-terminal region (ARP32743_T100)

Catalog#: ARP32743_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-130666 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%; Sheep: 100%
Complete computational species homology dataAnti-FOXP3 (ARP32743_T100)
Peptide SequenceSynthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FOXP3 (ARP32743_T100) antibody is Catalog # AAP32743 (Previous Catalog # AAPP03757)
Datasheets/ManualsPrintable datasheet for anti-FOXP3 (ARP32743_T100) antibody
Target ReferenceTakahata,Y., et al., (2004) Exp.Hematol.32(7),622-629
Publications

Kawabata, A. et al. Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses. Cytotherapy 15, 586-97 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23474329

Gene SymbolFOXP3
Official Gene Full NameForkhead box P3
Alias SymbolsJM2, AIID, IPEX, PIDX, XPID, DIETER
NCBI Gene Id50943
Protein NameForkhead box protein P3
Description of TargetForkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Swissprot IdQ9BZS1
Protein Accession #NP_054728
Nucleotide Accession #NM_014009
Protein Size (# AA)431
Molecular Weight47kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FOXP3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FOXP3.
Protein InteractionsPRR20A; RBPMS; STUB1; UBC; HSPA1A; IKZF3; GATA3; RUNX1; RELA; NFATC1; HIST1H1B; HDAC1; KAT8; REL; IKZF4; NFAT5; NFATC2; HDAC4; HDAC2; HDAC7; KAT5; HDAC9;
Write Your Own Review
You're reviewing:FOXP3 Antibody - N-terminal region (ARP32743_T100)
Your Rating
Aviva Tips and Tricks
Aviva ChIP Antibodies
Assay Development
Aviva HIS tag Deal