Search Antibody, Protein, and ELISA Kit Solutions

FOXP3 Antibody - N-terminal region (ARP32743_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32743_T100-FITC Conjugated

ARP32743_T100-HRP Conjugated

ARP32743_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130666 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%; Sheep: 100%
Complete computational species homology data:
Anti-FOXP3 (ARP32743_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FOXP3 (ARP32743_T100) antibody is Catalog # AAP32743 (Previous Catalog # AAPP03757)
Printable datasheet for anti-FOXP3 (ARP32743_T100) antibody
Target Reference:
Takahata,Y., et al., (2004) Exp.Hematol.32(7),622-629

Kawabata, A. et al. Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses. Cytotherapy 15, 586-97 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23474329

Gene Symbol:
Official Gene Full Name:
Forkhead box P3
Alias Symbols:
NCBI Gene Id:
Protein Name:
Forkhead box protein P3
Description of Target:
Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXP3.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...