Size:100 ul
$249.00
In Stock
SKU
ARP32743_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32743_T100-FITC Conjugated

ARP32743_T100-HRP Conjugated

ARP32743_T100-Biotin Conjugated

FOXP3 Antibody - N-terminal region (ARP32743_T100)

Catalog#: ARP32743_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130666 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%; Sheep: 100%
Complete computational species homology data Anti-FOXP3 (ARP32743_T100)
Peptide Sequence Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXP3 (ARP32743_T100) antibody is Catalog # AAP32743 (Previous Catalog # AAPP03757)
Datasheets/Manuals Printable datasheet for anti-FOXP3 (ARP32743_T100) antibody
Target Reference Takahata,Y., et al., (2004) Exp.Hematol.32(7),622-629
Publications

Kawabata, A. et al. Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses. Cytotherapy 15, 586-97 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23474329

Gene Symbol FOXP3
Official Gene Full Name Forkhead box P3
Alias Symbols JM2, AIID, IPEX, PIDX, XPID, DIETER
NCBI Gene Id 50943
Protein Name Forkhead box protein P3
Description of Target Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Swissprot Id Q9BZS1
Protein Accession # NP_054728
Nucleotide Accession # NM_014009
Protein Size (# AA) 431
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXP3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXP3.
Protein Interactions PRR20A; RBPMS; STUB1; UBC; HSPA1A; IKZF3; GATA3; RUNX1; RELA; NFATC1; HIST1H1B; HDAC1; KAT8; REL; IKZF4; NFAT5; NFATC2; HDAC4; HDAC2; HDAC7; KAT5; HDAC9;
  1. What is the species homology for "FOXP3 Antibody - N-terminal region (ARP32743_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "FOXP3 Antibody - N-terminal region (ARP32743_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXP3 Antibody - N-terminal region (ARP32743_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXP3 Antibody - N-terminal region (ARP32743_T100)"?

    This target may also be called "JM2, AIID, IPEX, PIDX, XPID, DIETER" in publications.

  5. What is the shipping cost for "FOXP3 Antibody - N-terminal region (ARP32743_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXP3 Antibody - N-terminal region (ARP32743_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXP3 Antibody - N-terminal region (ARP32743_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXP3 Antibody - N-terminal region (ARP32743_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXP3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXP3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXP3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXP3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXP3 Antibody - N-terminal region (ARP32743_T100)
Your Rating
We found other products you might like!