Search Antibody, Protein, and ELISA Kit Solutions

FOXP3 antibody - N-terminal region (ARP32743_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32743_T100-FITC Conjugated

ARP32743_T100-HRP Conjugated

ARP32743_T100-Biotin Conjugated

Gene Symbol:
FOXP3
NCBI Gene Id:
50943
Official Gene Full Name:
Forkhead box P3
Protein Name:
Forkhead box protein P3
Swissprot Id:
Q9BZS1
Protein Accession #:
NP_054728
Nucleotide Accession #:
NM_014009
Alias Symbols:
JM2, AIID, IPEX, PIDX, XPID, DIETER
Replacement Item:
This antibody may replace item sc-130666 from Santa Cruz Biotechnology.
Description of Target:
Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Protein Size (# AA):
431
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%; Sheep: 100%
Complete computational species homology data:
Anti-FOXP3 (ARP32743_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRR20A; RBPMS; STUB1; UBC; HSPA1A; IKZF3; GATA3; RUNX1; RELA; NFATC1; HIST1H1B; HDAC1; KAT8; REL; IKZF4; NFAT5; NFATC2; HDAC4; HDAC2; HDAC7; KAT5; HDAC9;
Blocking Peptide:
For anti-FOXP3 (ARP32743_T100) antibody is Catalog # AAP32743 (Previous Catalog # AAPP03757)
Datasheets/Manuals:
Printable datasheet for anti-FOXP3 (ARP32743_T100) antibody
Target Reference:
Takahata,Y., et al., (2004) Exp.Hematol.32(7),622-629
Publications:

Kawabata, A. et al. Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses. Cytotherapy 15, 586-97 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23474329

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...