Search Antibody, Protein, and ELISA Kit Solutions

Foxo4 Antibody - C-terminal region (ARP38710_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38710_P050-FITC Conjugated

ARP38710_P050-HRP Conjugated

ARP38710_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Forkhead box O4
NCBI Gene Id:
Protein Name:
Histone acetyltransferase KAT5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Afxh, MGC117660, Mllt7, afx
Replacement Item:
This antibody may replace item sc-34899 from Santa Cruz Biotechnology.
Description of Target:
Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Foxo4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Foxo4.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-Foxo4 (ARP38710_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Foxo4 (ARP38710_P050) antibody is Catalog # AAP38710
Printable datasheet for anti-Foxo4 (ARP38710_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...