FOXK2 Antibody - middle region : HRP (ARP34775_P050-HRP)

Catalog No: ARP34775_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXK2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 79%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FOXK2 (ARP34775_P050-HRP) antibody is Catalog # AAP34775 (Previous Catalog # AAPP05969)
• Sample Type Confirmation:

  FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

• Reference: Liu,P.P., et al., (2002) Proteins 49 (4), 543-553
• Publications:

  Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). WB, Human, Bovine, Pig, Horse, Rat, Mouse, Dog, Rabbit 20053746

Target Info

• Gene Symbol: FOXK2
• Gene Full Name: Forkhead box K2
• Alias Symbols: ILF, ILF1, ILF-1, nGTBP
• NCBI Gene Id: 3607
• Protein Name: Forkhead box protein K2
• Description of Target: FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
• Uniprot ID: Q01167
• Protein Accession #: NP_004505
• Nucleotide Accession #: NM_004514
• Protein Size (# AA): 660
• Molecular Weight: 69kDa
• Protein Interactions: HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;