Catalog No: ARP34775_P050
Price: $0.00
SKU
ARP34775_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
View product citations for antibody ARP34775_P050 on CiteAb
Datasheets/ManualsPrintable datasheet for anti-FOXK2 (ARP34775_P050) antibody
Product Info
Publications

Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). 20053746

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOXK2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 79%; Rat: 91%
Peptide SequenceSynthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
Concentration0.5 mg/ml
Blocking PeptideFor anti-FOXK2 (ARP34775_P050) antibody is Catalog # AAP34775 (Previous Catalog # AAPP05969)
Sample Type Confirmation

FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

ReferenceLiu,P.P., et al., (2002) Proteins 49 (4), 543-553
Gene SymbolFOXK2
Gene Full NameForkhead box K2
Alias SymbolsILF, ILF1, ILF-1, nGTBP
NCBI Gene Id3607
Protein NameForkhead box protein K2
Description of TargetFOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Uniprot IDQ01167
Protein Accession #NP_004505
Nucleotide Accession #NM_004514
Protein Size (# AA)660
Molecular Weight69kDa
Protein InteractionsHECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;
  1. What is the species homology for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "FOXK2 Antibody - middle region (ARP34775_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXK2 Antibody - middle region (ARP34775_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    This target may also be called "ILF, ILF1, ILF-1, nGTBP" in publications.

  5. What is the shipping cost for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FOXK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXK2 Antibody - middle region (ARP34775_P050)
Your Rating
We found other products you might like!