Search Antibody, Protein, and ELISA Kit Solutions

FOXK2 Antibody - middle region (ARP34775_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34775_P050-FITC Conjugated

ARP34775_P050-HRP Conjugated

ARP34775_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-103504 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human FOXK2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 79%; Rat: 91%
Complete computational species homology data:
Anti-FOXK2 (ARP34775_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FOXK2 (ARP34775_P050) antibody is Catalog # AAP34775 (Previous Catalog # AAPP05969)
Printable datasheet for anti-FOXK2 (ARP34775_P050) antibody
Sample Type Confirmation:

FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

Target Reference:
Liu,P.P., et al., (2002) Proteins 49 (4), 543-553

Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20053746

Gene Symbol:
Official Gene Full Name:
Forkhead box K2
Alias Symbols:
NCBI Gene Id:
Protein Name:
Forkhead box protein K2
Description of Target:
FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXK2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...