Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP34775_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34775_P050-FITC Conjugated

ARP34775_P050-HRP Conjugated

ARP34775_P050-Biotin Conjugated

FOXK2 Antibody - middle region (ARP34775_P050)

Catalog#: ARP34775_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-103504 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FOXK2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 79%; Rat: 91%
Complete computational species homology data Anti-FOXK2 (ARP34775_P050)
Peptide Sequence Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXK2 (ARP34775_P050) antibody is Catalog # AAP34775 (Previous Catalog # AAPP05969)
Datasheets/Manuals Printable datasheet for anti-FOXK2 (ARP34775_P050) antibody
Sample Type Confirmation

FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

Target Reference Liu,P.P., et al., (2002) Proteins 49 (4), 543-553
Publications

Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20053746

Gene Symbol FOXK2
Official Gene Full Name Forkhead box K2
Alias Symbols ILF, ILF-1, ILF1
NCBI Gene Id 3607
Protein Name Forkhead box protein K2
Description of Target FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Swissprot Id Q01167
Protein Accession # NP_004505
Nucleotide Accession # NM_004514
Protein Size (# AA) 660
Molecular Weight 69kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXK2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXK2.
Protein Interactions HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;
  1. What is the species homology for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "FOXK2 Antibody - middle region (ARP34775_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXK2 Antibody - middle region (ARP34775_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    This target may also be called "ILF, ILF-1, ILF1" in publications.

  5. What is the shipping cost for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXK2 Antibody - middle region (ARP34775_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXK2 Antibody - middle region (ARP34775_P050)
Your Rating
We found other products you might like!