Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP34775_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34775_P050-FITC Conjugated

ARP34775_P050-HRP Conjugated

ARP34775_P050-Biotin Conjugated

FOXK2 Antibody - middle region (ARP34775_P050)

Catalog#: ARP34775_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-103504 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOXK2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 79%; Rat: 91%
Complete computational species homology dataAnti-FOXK2 (ARP34775_P050)
Peptide SequenceSynthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FOXK2 (ARP34775_P050) antibody is Catalog # AAP34775 (Previous Catalog # AAPP05969)
Datasheets/ManualsPrintable datasheet for anti-FOXK2 (ARP34775_P050) antibody
Sample Type Confirmation

FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

Target ReferenceLiu,P.P., et al., (2002) Proteins 49 (4), 543-553
Publications

Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20053746

Gene SymbolFOXK2
Official Gene Full NameForkhead box K2
Alias SymbolsILF, ILF-1, ILF1
NCBI Gene Id3607
Protein NameForkhead box protein K2
Description of TargetFOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Swissprot IdQ01167
Protein Accession #NP_004505
Nucleotide Accession #NM_004514
Protein Size (# AA)660
Molecular Weight69kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FOXK2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FOXK2.
Protein InteractionsHECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;
Write Your Own Review
You're reviewing:FOXK2 Antibody - middle region (ARP34775_P050)
Your Rating
Aviva Live Chat
Aviva Tips and Tricks
Aviva HIS tag Deal
Aviva Blast Tool