Search Antibody, Protein, and ELISA Kit Solutions

FOXK2 Antibody - C-terminal region (ARP34875_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34875_P050-FITC Conjugated

ARP34875_P050-HRP Conjugated

ARP34875_P050-Biotin Conjugated

Gene Symbol:
FOXK2
Official Gene Full Name:
Forkhead box K2
NCBI Gene Id:
3607
Protein Name:
Forkhead box protein K2
Swissprot Id:
Q01167-3
Protein Accession #:
NP_852096
Nucleotide Accession #:
NM_181431
Alias Symbols:
ILF, ILF-1, ILF1
Replacement Item:
This antibody may replace item sc-103504 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
Protein Size (# AA):
328
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXK2.
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-FOXK2 (ARP34875_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKAP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;
Blocking Peptide:
For anti-FOXK2 (ARP34875_P050) antibody is Catalog # AAP34875
Datasheets/Manuals:
Printable datasheet for anti-FOXK2 (ARP34875_P050) antibody
Sample Type Confirmation:

FOXK2 is supported by BioGPS gene expression data to be expressed in HEK293T

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...