Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34875_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34875_P050-FITC Conjugated

ARP34875_P050-HRP Conjugated

ARP34875_P050-Biotin Conjugated

FOXK2 Antibody - C-terminal region (ARP34875_P050)

Catalog#: ARP34875_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-103504 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-FOXK2 (ARP34875_P050)
Peptide Sequence Synthetic peptide located within the following region: KQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKAP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXK2 (ARP34875_P050) antibody is Catalog # AAP34875
Datasheets/Manuals Printable datasheet for anti-FOXK2 (ARP34875_P050) antibody
Sample Type Confirmation

FOXK2 is supported by BioGPS gene expression data to be expressed in HEK293T

Gene Symbol FOXK2
Official Gene Full Name Forkhead box K2
Alias Symbols ILF, ILF-1, ILF1
NCBI Gene Id 3607
Protein Name Forkhead box protein K2
Description of Target The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
Swissprot Id Q01167-3
Protein Accession # NP_852096
Nucleotide Accession # NM_181431
Protein Size (# AA) 328
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXK2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXK2.
Protein Interactions HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;
  1. What is the species homology for "FOXK2 Antibody - C-terminal region (ARP34875_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "FOXK2 Antibody - C-terminal region (ARP34875_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXK2 Antibody - C-terminal region (ARP34875_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXK2 Antibody - C-terminal region (ARP34875_P050)"?

    This target may also be called "ILF, ILF-1, ILF1" in publications.

  5. What is the shipping cost for "FOXK2 Antibody - C-terminal region (ARP34875_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXK2 Antibody - C-terminal region (ARP34875_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXK2 Antibody - C-terminal region (ARP34875_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXK2 Antibody - C-terminal region (ARP34875_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXK2 Antibody - C-terminal region (ARP34875_P050)
Your Rating
We found other products you might like!