Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP72231_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP72231_P050-FITC Conjugated

ARP72231_P050-HRP Conjugated

ARP72231_P050-Biotin Conjugated

FOXD4L1 Antibody - N-terminal region (ARP72231_P050)

Catalog#: ARP72231_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Human, Pig, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-94836 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human FOXD4L1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Human: 100%; Pig: 86%; Rabbit: 79%
Peptide Sequence Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXD4L1 (ARP72231_P050) antibody is Catalog # AAP72231
Datasheets/Manuals Printable datasheet for anti-FOXD4L1 (ARP72231_P050) antibody
Gene Symbol FOXD4L1
Alias Symbols FOXD5, bA395L14.1
NCBI Gene Id 200350
Description of Target This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found.
Swissprot Id Q9NU39
Protein Accession # NP_036316
Nucleotide Accession # NM_012184
Protein Size (# AA) 408
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXD4L1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXD4L1.
  1. What is the species homology for "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Human, Pig, Rabbit".

  2. How long will it take to receive "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)"?

    This target may also be called "FOXD5, bA395L14.1" in publications.

  5. What is the shipping cost for "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXD4L1 Antibody - N-terminal region (ARP72231_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXD4L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXD4L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXD4L1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXD4L1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXD4L1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXD4L1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXD4L1 Antibody - N-terminal region (ARP72231_P050)
Your Rating