Search Antibody, Protein, and ELISA Kit Solutions

FOXD4L1 Antibody - N-terminal region (ARP72231_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72231_P050-FITC Conjugated

ARP72231_P050-HRP Conjugated

ARP72231_P050-Biotin Conjugated

Gene Symbol:
FOXD4L1
NCBI Gene Id:
200350
Swissprot Id:
Q9NU39
Protein Accession #:
NP_036316
Nucleotide Accession #:
NM_012184
Alias Symbols:
FOXD5, bA395L14.1
Replacement Item:
This antibody may replace item sc-94836 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found.
Protein Size (# AA):
408
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXD4L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXD4L1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FOXD4L1
Predicted Species Reactivity:
Cow, Human, Pig, Rabbit
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Human: 100%; Pig: 86%; Rabbit: 79%
Peptide Sequence:
Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FOXD4L1 (ARP72231_P050) antibody is Catalog # AAP72231
Datasheets/Manuals:
Printable datasheet for anti-FOXD4L1 (ARP72231_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...