Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP47769_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47769_P050-FITC Conjugated

ARP47769_P050-HRP Conjugated

ARP47769_P050-Biotin Conjugated

FOXD4 Antibody - middle region (ARP47769_P050)

Catalog#: ARP47769_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-145223 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FOXD4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Horse: 79%; Human: 100%; Rabbit: 85%; Rat: 79%
Complete computational species homology data Anti-FOXD4 (ARP47769_P050)
Peptide Sequence Synthetic peptide located within the following region: DPASQDMFDNGSFLRRRKRFQRHQPTPGAHLPHPFPLPAAHAALHNPRPG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXD4 (ARP47769_P050) antibody is Catalog # AAP47769 (Previous Catalog # AAPP28608)
Datasheets/Manuals Printable datasheet for anti-FOXD4 (ARP47769_P050) antibody
Sample Type Confirmation

FOXD4 is supported by BioGPS gene expression data to be expressed in 721_B

Gene Symbol FOXD4
Official Gene Full Name Forkhead box D4
Alias Symbols FKHL9, FOXD4A, FREAC5, MGC105106
NCBI Gene Id 2298
Protein Name Forkhead box protein D4
Description of Target FOXD4 contains 1 fork-head DNA-binding domain. The W148R mutation in the forkhead domain of FOXD4, possibly resultsin reduced DNA binding capacity and altered transcriptional activity.
Swissprot Id Q12950
Protein Accession # NP_997188
Nucleotide Accession # NM_207305
Protein Size (# AA) 439
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXD4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXD4.
  1. What is the species homology for "FOXD4 Antibody - middle region (ARP47769_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Horse, Human, Rabbit, Rat".

  2. How long will it take to receive "FOXD4 Antibody - middle region (ARP47769_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXD4 Antibody - middle region (ARP47769_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXD4 Antibody - middle region (ARP47769_P050)"?

    This target may also be called "FKHL9, FOXD4A, FREAC5, MGC105106" in publications.

  5. What is the shipping cost for "FOXD4 Antibody - middle region (ARP47769_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXD4 Antibody - middle region (ARP47769_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXD4 Antibody - middle region (ARP47769_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXD4 Antibody - middle region (ARP47769_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXD4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXD4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXD4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXD4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXD4 Antibody - middle region (ARP47769_P050)
Your Rating