Search Antibody, Protein, and ELISA Kit Solutions

FOXD4 Antibody - middle region (ARP47769_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47769_P050-FITC Conjugated

ARP47769_P050-HRP Conjugated

ARP47769_P050-Biotin Conjugated

Gene Symbol:
FOXD4
Official Gene Full Name:
Forkhead box D4
NCBI Gene Id:
2298
Protein Name:
Forkhead box protein D4
Swissprot Id:
Q12950
Protein Accession #:
NP_997188
Nucleotide Accession #:
NM_207305
Alias Symbols:
FKHL9, FOXD4A, FREAC5, MGC105106
Replacement Item:
This antibody may replace item sc-145223 from Santa Cruz Biotechnology.
Description of Target:
FOXD4 contains 1 fork-head DNA-binding domain. The W148R mutation in the forkhead domain of FOXD4, possibly resultsin reduced DNA binding capacity and altered transcriptional activity.
Protein Size (# AA):
439
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXD4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXD4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FOXD4
Predicted Species Reactivity:
Horse, Human, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Horse: 79%; Human: 100%; Rabbit: 85%; Rat: 79%
Complete computational species homology data:
Anti-FOXD4 (ARP47769_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPASQDMFDNGSFLRRRKRFQRHQPTPGAHLPHPFPLPAAHAALHNPRPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FOXD4 (ARP47769_P050) antibody is Catalog # AAP47769 (Previous Catalog # AAPP28608)
Datasheets/Manuals:
Printable datasheet for anti-FOXD4 (ARP47769_P050) antibody
Sample Type Confirmation:

FOXD4 is supported by BioGPS gene expression data to be expressed in 721_B

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...