SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31945_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP31945_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-FOXA3 (ARP31945_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOXA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
Concentration0.5 mg/ml
Blocking PeptideFor anti-FOXA3 (ARP31945_P050-HRP) antibody is Catalog # AAP31945 (Previous Catalog # AAPP03641)
ReferenceKaestner,K.H. et al., (2000) Trends Endocrinol. Metab. 11 (7), 281-285
Publications

Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). WB, Dog, Pig, Rat, Guinea pig, Human, Bovine, Horse, Mouse, Rabbit, Zebrafish 22959654

Gene SymbolFOXA3
Gene Full NameForkhead box A3
Alias SymbolsFKHH3, HNF3G, TCF3G
NCBI Gene Id3171
Protein NameHepatocyte nuclear factor 3-gamma
Description of TargetFOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
Uniprot IDP55318
Protein Accession #NP_004488
Nucleotide Accession #NM_004497
Protein Size (# AA)350
Molecular Weight37kDa
Protein InteractionsPPARA; ALX4; TLE2; TLE1; HMGB1;
  1. What is the species homology for "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)"?

    This target may also be called "FKHH3, HNF3G, TCF3G" in publications.

  5. What is the shipping cost for "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FOXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXA3 Antibody - middle region : HRP (ARP31945_P050-HRP)
Your Rating
We found other products you might like!