Size:100 ul
$319.00
In Stock
SKU
ARP31945_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31945_P050-FITC Conjugated

ARP31945_P050-HRP Conjugated

ARP31945_P050-Biotin Conjugated

FOXA3 Antibody - middle region (ARP31945_P050)

Catalog#: ARP31945_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-111854 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOXA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Zebrafish: 79%
Complete computational species homology dataAnti-FOXA3 (ARP31945_P050)
Peptide SequenceSynthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FOXA3 (ARP31945_P050) antibody is Catalog # AAP31945 (Previous Catalog # AAPP03641)
Datasheets/ManualsPrintable datasheet for anti-FOXA3 (ARP31945_P050) antibody
Target ReferenceKaestner,K.H. et al., (2000) Trends Endocrinol. Metab. 11 (7), 281-285
Publications

Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22959654

Gene SymbolFOXA3
Official Gene Full NameForkhead box A3
Alias SymbolsFKHH3, HNF3G, TCF3G
NCBI Gene Id3171
Protein NameHepatocyte nuclear factor 3-gamma
Description of TargetFOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
Swissprot IdP55318
Protein Accession #NP_004488
Nucleotide Accession #NM_004497
Protein Size (# AA)350
Molecular Weight37kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FOXA3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FOXA3.
Protein InteractionsPPARA; ALX4; TLE2; TLE1; HMGB1;
Write Your Own Review
You're reviewing:FOXA3 Antibody - middle region (ARP31945_P050)
Your Rating
Aviva Live Chat
Aviva Validation Data
Aviva Travel Grant
Aviva Blast Tool