Search Antibody, Protein, and ELISA Kit Solutions

FOXA3 Antibody - middle region (ARP31945_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31945_P050-FITC Conjugated

ARP31945_P050-HRP Conjugated

ARP31945_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-111854 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FOXA3
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-FOXA3 (ARP31945_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FOXA3 (ARP31945_P050) antibody is Catalog # AAP31945 (Previous Catalog # AAPP03641)
Datasheets/Manuals:
Printable datasheet for anti-FOXA3 (ARP31945_P050) antibody
Target Reference:
Kaestner,K.H. et al., (2000) Trends Endocrinol. Metab. 11 (7), 281-285
Publications:

Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22959654

Gene Symbol:
FOXA3
Official Gene Full Name:
Forkhead box A3
Alias Symbols:
FKHH3, HNF3G, TCF3G
NCBI Gene Id:
3171
Protein Name:
Hepatocyte nuclear factor 3-gamma
Description of Target:
FOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
Swissprot Id:
P55318
Protein Accession #:
NP_004488
Nucleotide Accession #:
NM_004497
Protein Size (# AA):
350
Molecular Weight:
37kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXA3.
Protein Interactions:
PPARA; ALX4; TLE2; TLE1; HMGB1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...