Size:100 ul
$319.00
In Stock
SKU
ARP31945_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31945_P050-FITC Conjugated

ARP31945_P050-HRP Conjugated

ARP31945_P050-Biotin Conjugated

FOXA3 Antibody - middle region (ARP31945_P050)

Catalog#: ARP31945_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111854 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FOXA3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-FOXA3 (ARP31945_P050)
Peptide Sequence Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FOXA3 (ARP31945_P050) antibody is Catalog # AAP31945 (Previous Catalog # AAPP03641)
Datasheets/Manuals Printable datasheet for anti-FOXA3 (ARP31945_P050) antibody
Target Reference Kaestner,K.H. et al., (2000) Trends Endocrinol. Metab. 11 (7), 281-285
Publications

Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22959654

Gene Symbol FOXA3
Official Gene Full Name Forkhead box A3
Alias Symbols FKHH3, HNF3G, TCF3G
NCBI Gene Id 3171
Protein Name Hepatocyte nuclear factor 3-gamma
Description of Target FOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
Swissprot Id P55318
Protein Accession # NP_004488
Nucleotide Accession # NM_004497
Protein Size (# AA) 350
Molecular Weight 37kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXA3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXA3.
Protein Interactions PPARA; ALX4; TLE2; TLE1; HMGB1;
  1. What is the species homology for "FOXA3 Antibody - middle region (ARP31945_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FOXA3 Antibody - middle region (ARP31945_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXA3 Antibody - middle region (ARP31945_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXA3 Antibody - middle region (ARP31945_P050)"?

    This target may also be called "FKHH3, HNF3G, TCF3G" in publications.

  5. What is the shipping cost for "FOXA3 Antibody - middle region (ARP31945_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXA3 Antibody - middle region (ARP31945_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXA3 Antibody - middle region (ARP31945_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXA3 Antibody - middle region (ARP31945_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FOXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXA3 Antibody - middle region (ARP31945_P050)
Your Rating
We found other products you might like!