Search Antibody, Protein, and ELISA Kit Solutions

FOSL1 antibody - middle region (ARP31377_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31377_P050-FITC Conjugated

ARP31377_P050-HRP Conjugated

ARP31377_P050-Biotin Conjugated

Gene Symbol:
FOSL1
NCBI Gene Id:
8061
Official Gene Full Name:
FOS-like antigen 1
Protein Name:
Fos-related antigen 1
Swissprot Id:
P15407
Protein Accession #:
NP_005429
Nucleotide Accession #:
NM_005438
Alias Symbols:
FRA1, fra-1, FRA
Replacement Item:
This antibody may replace item sc-113305 from Santa Cruz Biotechnology.
Description of Target:
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Protein Size (# AA):
271
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOSL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOSL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FOSL1
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 85%; Zebrafish: 85%
Complete computational species homology data:
Anti-FOSL1 (ARP31377_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NME7; CREB5; USF1; LDOC1; JUNB; MAFB; MAF; JUN; DDIT3; ATF2; CEBPG; CEBPE; CEBPA; ATF4; ATF3; PARVG; WFDC1; TAB2; ATXN1; MYC; KPNA1; PSMC3; EP300; CREBBP; TRIM24; UBC; HDAC1; CALCOCO1; ATF1; CREB1; SRF; ELK1;
Blocking Peptide:
For anti-FOSL1 (ARP31377_P050) antibody is Catalog # AAP31377 (Previous Catalog # AAPP02132)
Datasheets/Manuals:
Printable datasheet for anti-FOSL1 (ARP31377_P050) antibody
Target Reference:
Debinski,W. (2005) Mol. Cancer Res. 3 (4), 237-249
Publications:

Yang, L. et al. Biological function and prognostic significance of peroxisome proliferator-activated receptor δ in rectal cancer. Clin. Cancer Res. 17, 3760-70 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21499227

Seitz, O., Schürmann, C., Pfeilschifter, J., Frank, S. & Sader, R. Identification of the Fra-1 transcription factor in healing skin flaps transplants: a potential role as a negative regulator of VEGF release from keratinocytes. J. Craniomaxillofac. Surg. 40, 379-86 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21840727

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...