Size:100 ul
$319.00
In Stock
SKU
ARP31377_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31377_P050-FITC Conjugated

ARP31377_P050-HRP Conjugated

ARP31377_P050-Biotin Conjugated

FOSL1 Antibody - middle region (ARP31377_P050)

Catalog#: ARP31377_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-113305 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOSL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 85%; Zebrafish: 85%
Complete computational species homology dataAnti-FOSL1 (ARP31377_P050)
Peptide SequenceSynthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FOSL1 (ARP31377_P050) antibody is Catalog # AAP31377 (Previous Catalog # AAPP02132)
Datasheets/ManualsPrintable datasheet for anti-FOSL1 (ARP31377_P050) antibody
Target ReferenceDebinski,W. (2005) Mol. Cancer Res. 3 (4), 237-249
Publications

Seitz, O., Schürmann, C., Pfeilschifter, J., Frank, S. & Sader, R. Identification of the Fra-1 transcription factor in healing skin flaps transplants: a potential role as a negative regulator of VEGF release from keratinocytes. J. Craniomaxillofac. Surg. 40, 379-86 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21840727

Yang, L. et al. Biological function and prognostic significance of peroxisome proliferator-activated receptor δ in rectal cancer. Clin. Cancer Res. 17, 3760-70 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21499227

Gene SymbolFOSL1
Official Gene Full NameFOS-like antigen 1
Alias SymbolsFRA1, fra-1, FRA
NCBI Gene Id8061
Protein NameFos-related antigen 1
Description of TargetThe Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Swissprot IdP15407
Protein Accession #NP_005429
Nucleotide Accession #NM_005438
Protein Size (# AA)271
Molecular Weight29kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FOSL1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FOSL1.
Protein InteractionsNME7; CREB5; USF1; LDOC1; JUNB; MAFB; MAF; JUN; DDIT3; ATF2; CEBPG; CEBPE; CEBPA; ATF4; ATF3; PARVG; WFDC1; TAB2; ATXN1; MYC; KPNA1; PSMC3; EP300; CREBBP; TRIM24; UBC; HDAC1; CALCOCO1; ATF1; CREB1; SRF; ELK1;
Write Your Own Review
You're reviewing:FOSL1 Antibody - middle region (ARP31377_P050)
Your Rating
Assay Development
Aviva Pathways
Free Microscope
Aviva Tissue Tool