Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FOLR1 antibody - middle region (ARP41427_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP41427_P050-FITC Conjugated

ARP41427_P050-HRP Conjugated

ARP41427_P050-Biotin Conjugated

Gene Symbol:
FOLR1
NCBI Gene Id:
2348
Official Gene Full Name:
Folate receptor 1 (adult)
Protein Name:
Folate receptor alpha
Swissprot Id:
P15328
Protein Accession #:
NP_000793
Nucleotide Accession #:
NM_000802
Alias Symbols:
FBP, FOLR, FR-alpha, MOv18
Replacement Item:
This antibody may replace item sc-16386 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anc
Protein Size (# AA):
257
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOLR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOLR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FOLR1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-FOLR1 (ARP41427_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
AGO2; NCAPH2; IRAK3; CUL3; PSMB2; IMPDH2; GSR; UBC; Poc1b; Cep76; Trim69; Dync1h1; Cdk1; Cbx1; LYN;
Blocking Peptide:
For anti-FOLR1 (ARP41427_P050) antibody is Catalog # AAP41427 (Previous Catalog # AAPP24165)
Datasheets/Manuals:
Printable datasheet for anti-FOLR1 (ARP41427_P050) antibody
Sample Type Confirmation:

FOLR1 is supported by BioGPS gene expression data to be expressed in PANC1

Target Reference:
Iwakiri,S., (2008) Ann. Surg. Oncol. 15 (3), 889-899

Tell us what you think about this item!

Write A Review
    Please, wait...