Search Antibody, Protein, and ELISA Kit Solutions

FMO5 Antibody - middle region (ARP45115_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP45115_P050-FITC Conjugated

ARP45115_P050-HRP Conjugated

ARP45115_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-103494 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human FMO5
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-FMO5 (ARP45115_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FMO5 (ARP45115_P050) antibody is Catalog # AAP45115 (Previous Catalog # AAPP26106)
Printable datasheet for anti-FMO5 (ARP45115_P050) antibody
Target Reference:
Gregory,S.G., (2006) Nature 441 (7091), 315-321
Gene Symbol:
Official Gene Full Name:
Flavin containing monooxygenase 5
Alias Symbols:
NCBI Gene Id:
Protein Name:
Dimethylaniline monooxygenase [N-oxide-forming] 5
Description of Target:
Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FMO5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FMO5.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...