Search Antibody, Protein, and ELISA Kit Solutions

FMO3 antibody - N-terminal region (ARP44434_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44434_P050-FITC Conjugated

ARP44434_P050-HRP Conjugated

ARP44434_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Flavin containing monooxygenase 3
Protein Name:
Dimethylaniline monooxygenase [N-oxide-forming] 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FMOII, MGC34400, dJ127D3.1, TMAU
Replacement Item:
This antibody may replace item sc-51288 from Santa Cruz Biotechnology.
Description of Target:
FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FMO3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FMO3.
The immunogen is a synthetic peptide directed towards the N terminal region of human FMO3
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 90%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-FMO3 (ARP44434_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FMO3 (ARP44434_P050) antibody is Catalog # AAP44434 (Previous Catalog # AAPP25744)
Printable datasheet for anti-FMO3 (ARP44434_P050) antibody
Target Reference:
Zhang,J. (2006) Drug Metab. Dispos. 34 (1), 19-26

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...