Search Antibody, Protein, and ELISA Kit Solutions

FLNC Antibody - N-terminal region (ARP64454_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP64454_P050-FITC Conjugated

ARP64454_P050-HRP Conjugated

ARP64454_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-48495 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FLNC
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-FLNC (ARP64454_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FLNC (ARP64454_P050) antibody is Catalog # AAP64454
Datasheets/Manuals:
Printable datasheet for anti-FLNC (ARP64454_P050) antibody
Publications:

Begay, RL; Tharp, CA; Martin, A; Graw, SL; Sinagra, G; Miani, D; Sweet, ME; Slavov, DB; Stafford, N; Zeller, MJ; Alnefaie, R; Rowland, TJ; Brun, F; Jones, KL; Gowan, K; Mestroni, L; Garrity, DM; Taylor, MR; FLNC Gene Splice Mutations Cause Dilated Cardiomyopathy. 1, 344-359 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 28008423

Gene Symbol:
FLNC
Official Gene Full Name:
Filamin C, gamma
Alias Symbols:
ABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2
NCBI Gene Id:
2318
Protein Name:
Filamin-C
Description of Target:
This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id:
Q14315
Protein Accession #:
NP_001120959
Nucleotide Accession #:
NM_001127487
Protein Size (# AA):
2692
Molecular Weight:
296kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FLNC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FLNC.
Protein Interactions:
RAPGEF2; TRIM63; TRIM55; XIRP1; XIRP2; SYNPO2; UBC; KCMF1; CTTNBP2NL; ANKRD28; ARFGEF2; NCAPD2; TXNL1; PSMD13; PSMD12; PSMD3; NUP88; IKBKB; FLNB; AP3S1; NPM1; IGSF8; FN1; IQCB1; TP63; VCAM1; RPS6KA2; DYNLRB1; NUP133; SAP30BP; SF3A3; SRSF9; ENO1; EEF1G; EE

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...