Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP64454_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64454_P050-FITC Conjugated

ARP64454_P050-HRP Conjugated

ARP64454_P050-Biotin Conjugated

FLNC Antibody - N-terminal region (ARP64454_P050)

Catalog#: ARP64454_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-48495 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human FLNC
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-FLNC (ARP64454_P050)
Peptide Sequence Synthetic peptide located within the following region: VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FLNC (ARP64454_P050) antibody is Catalog # AAP64454
Datasheets/Manuals Printable datasheet for anti-FLNC (ARP64454_P050) antibody
Publications

Begay, RL; Tharp, CA; Martin, A; Graw, SL; Sinagra, G; Miani, D; Sweet, ME; Slavov, DB; Stafford, N; Zeller, MJ; Alnefaie, R; Rowland, TJ; Brun, F; Jones, KL; Gowan, K; Mestroni, L; Garrity, DM; Taylor, MR; FLNC Gene Splice Mutations Cause Dilated Cardiomyopathy. 1, 344-359 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 28008423

Gene Symbol FLNC
Official Gene Full Name Filamin C, gamma
Alias Symbols ABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2
NCBI Gene Id 2318
Protein Name Filamin-C
Description of Target This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id Q14315
Protein Accession # NP_001120959
Nucleotide Accession # NM_001127487
Protein Size (# AA) 2692
Molecular Weight 296kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FLNC.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FLNC.
Protein Interactions RAPGEF2; TRIM63; TRIM55; XIRP1; XIRP2; SYNPO2; UBC; KCMF1; CTTNBP2NL; ANKRD28; ARFGEF2; NCAPD2; TXNL1; PSMD13; PSMD12; PSMD3; NUP88; IKBKB; FLNB; AP3S1; NPM1; IGSF8; FN1; IQCB1; TP63; VCAM1; RPS6KA2; DYNLRB1; NUP133; SAP30BP; SF3A3; SRSF9; ENO1; EEF1G; EE
  1. What is the species homology for "FLNC Antibody - N-terminal region (ARP64454_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FLNC Antibody - N-terminal region (ARP64454_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FLNC Antibody - N-terminal region (ARP64454_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FLNC Antibody - N-terminal region (ARP64454_P050)"?

    This target may also be called "ABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2" in publications.

  5. What is the shipping cost for "FLNC Antibody - N-terminal region (ARP64454_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FLNC Antibody - N-terminal region (ARP64454_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FLNC Antibody - N-terminal region (ARP64454_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "296kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FLNC Antibody - N-terminal region (ARP64454_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FLNC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FLNC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FLNC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FLNC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FLNC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FLNC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FLNC Antibody - N-terminal region (ARP64454_P050)
Your Rating
We found other products you might like!