Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP64454_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64454_P050-FITC Conjugated

ARP64454_P050-HRP Conjugated

ARP64454_P050-Biotin Conjugated

FLNC Antibody - N-terminal region (ARP64454_P050)

Catalog#: ARP64454_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-48495 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FLNC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-FLNC (ARP64454_P050)
Peptide SequenceSynthetic peptide located within the following region: VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FLNC (ARP64454_P050) antibody is Catalog # AAP64454
Datasheets/ManualsPrintable datasheet for anti-FLNC (ARP64454_P050) antibody
Publications

Begay, RL; Tharp, CA; Martin, A; Graw, SL; Sinagra, G; Miani, D; Sweet, ME; Slavov, DB; Stafford, N; Zeller, MJ; Alnefaie, R; Rowland, TJ; Brun, F; Jones, KL; Gowan, K; Mestroni, L; Garrity, DM; Taylor, MR; FLNC Gene Splice Mutations Cause Dilated Cardiomyopathy. 1, 344-359 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 28008423

Gene SymbolFLNC
Official Gene Full NameFilamin C, gamma
Alias SymbolsABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2
NCBI Gene Id2318
Protein NameFilamin-C
Description of TargetThis gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot IdQ14315
Protein Accession #NP_001120959
Nucleotide Accession #NM_001127487
Protein Size (# AA)2692
Molecular Weight296kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FLNC.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FLNC.
Protein InteractionsRAPGEF2; TRIM63; TRIM55; XIRP1; XIRP2; SYNPO2; UBC; KCMF1; CTTNBP2NL; ANKRD28; ARFGEF2; NCAPD2; TXNL1; PSMD13; PSMD12; PSMD3; NUP88; IKBKB; FLNB; AP3S1; NPM1; IGSF8; FN1; IQCB1; TP63; VCAM1; RPS6KA2; DYNLRB1; NUP133; SAP30BP; SF3A3; SRSF9; ENO1; EEF1G; EE
Write Your Own Review
You're reviewing:FLNC Antibody - N-terminal region (ARP64454_P050)
Your Rating
Aviva Blast Tool
Aviva Live Chat
Aviva Travel Grant
Aviva HIS tag Deal