SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33354_P050
Price: $0.00
SKU
ARP33354_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MEAF6 (ARP33354_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FLJ11730
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM
Concentration0.5 mg/ml
Blocking PeptideFor anti-MEAF6 (ARP33354_P050) antibody is Catalog # AAP33354 (Previous Catalog # AAPP04396)
Sample Type Confirmation

MEAF6 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceLee,S.Y., et al., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2651-2656
Gene SymbolMEAF6
Gene Full NameMYST/Esa1-associated factor 6
Alias SymbolsEAF6, CENP-28, C1orf149, NY-SAR-91
NCBI Gene Id64769
Protein NameChromatin modification-related protein MEAF6
Description of TargetThe screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognized by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them.
Uniprot IDQ86WE3
Protein Accession #NP_073593
Nucleotide Accession #NM_022756
Protein Size (# AA)201
Molecular Weight23kDa
Protein InteractionsPLEKHF2; TRIM54; LDOC1; UBC; FXR2; H2AFZ; ELAVL1; SUMO2; JADE1; KAT5; tat; MRGBP; ING5; KAT6A; BRPF1; CCDC85B; L3MBTL2; ING3; ING4; KAT7;
  1. What is the species homology for "FLJ11730 Antibody - N-terminal region (ARP33354_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Zebrafish".

  2. How long will it take to receive "FLJ11730 Antibody - N-terminal region (ARP33354_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FLJ11730 Antibody - N-terminal region (ARP33354_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FLJ11730 Antibody - N-terminal region (ARP33354_P050)"?

    This target may also be called "EAF6, CENP-28, C1orf149, NY-SAR-91" in publications.

  5. What is the shipping cost for "FLJ11730 Antibody - N-terminal region (ARP33354_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FLJ11730 Antibody - N-terminal region (ARP33354_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FLJ11730 Antibody - N-terminal region (ARP33354_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "23kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FLJ11730 Antibody - N-terminal region (ARP33354_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MEAF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MEAF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MEAF6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MEAF6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MEAF6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MEAF6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FLJ11730 Antibody - N-terminal region (ARP33354_P050)
Your Rating