Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP54614_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54614_P050-FITC Conjugated

ARP54614_P050-HRP Conjugated

ARP54614_P050-Biotin Conjugated

FLII Antibody - middle region (ARP54614_P050)

Catalog#: ARP54614_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-21716, HPA007084
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FLII
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-FLII (ARP54614_P050)
Peptide Sequence Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FLII (ARP54614_P050) antibody is Catalog # AAP54614 (Previous Catalog # AAPP31405)
Datasheets/Manuals Printable datasheet for anti-FLII (ARP54614_P050) antibody
Target Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Gene Symbol FLII
Official Gene Full Name Flightless I homolog (Drosophila)
Alias Symbols FLI, FLIL, Fli1, MGC39265
NCBI Gene Id 2314
Protein Name Protein flightless-1 homolog
Description of Target FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q13045
Protein Accession # NP_002009
Nucleotide Accession # NM_002018
Protein Size (# AA) 1269
Molecular Weight 145kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FLII.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FLII.
Protein Interactions UBC; SUMO2; C14orf166; RTCB; IGF2BP3; PDCD6; LRRFIP1; EIF2B3; RPL27; RFC4; RFC2; PRKDC; NMT1; HNRNPM; MRE11A; KRT18; DHX9; DDX1; PAN2; HSP90AA1; FMNL1; BRCA1; EIF1AX; DGCR8; FBXO25; LRRFIP2; MYD88; ESR1; ACTL6A; GRIP1; CARM1; TRAIP; PRMT1; OPTN; DLST; ACT
  1. What is the species homology for "FLII Antibody - middle region (ARP54614_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "FLII Antibody - middle region (ARP54614_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FLII Antibody - middle region (ARP54614_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FLII Antibody - middle region (ARP54614_P050)"?

    This target may also be called "FLI, FLIL, Fli1, MGC39265" in publications.

  5. What is the shipping cost for "FLII Antibody - middle region (ARP54614_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FLII Antibody - middle region (ARP54614_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FLII Antibody - middle region (ARP54614_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "145kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FLII Antibody - middle region (ARP54614_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FLII"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FLII"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FLII"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FLII"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FLII"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FLII"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FLII Antibody - middle region (ARP54614_P050)
Your Rating
We found other products you might like!