Search Antibody, Protein, and ELISA Kit Solutions

FLII Antibody - middle region (ARP54614_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54614_P050-FITC Conjugated

ARP54614_P050-HRP Conjugated

ARP54614_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Flightless I homolog (Drosophila)
NCBI Gene Id:
Protein Name:
Protein flightless-1 homolog
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLI, FLIL, Fli1, MGC39265
Replacement Item:
This antibody may replace item sc-21716, HPA007084
Description of Target:
FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FLII.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FLII.
The immunogen is a synthetic peptide directed towards the middle region of human FLII
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-FLII (ARP54614_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FLII (ARP54614_P050) antibody is Catalog # AAP54614 (Previous Catalog # AAPP31405)
Printable datasheet for anti-FLII (ARP54614_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...