SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP90634_P050
Price: $0.00
SKU
ARP90634_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FKBP4 (ARP90634_P050) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse FKBP4
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: EGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKA
Concentration0.5 mg/ml
Blocking PeptideFor anti-FKBP4 (ARP90634_P050) antibody is Catalog # AAP90634
Gene SymbolFKBP4
Gene Full NameFK506 binding protein 4
Alias Symbolsp59, FKBP5, FKBP-4, FKBP-5, FKBP52, FKPB52, FKBP-52, AL022792, AW208983
NCBI Gene Id14228
Protein Namepeptidyl-prolyl cis-trans isomerase FKBP4
Description of TargetImmunophilin protein with PPIase and co-chaperone activities. Component of steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments. The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening. Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly. May have a protective role against oxidative stress in mitochondria.
Uniprot IDP30416
Protein Accession #NP_034349.1
Nucleotide Accession #NM_010219.3
Protein Size (# AA)458
Molecular Weight52 kDa
  1. What is the species homology for "FKBP4 Antibody - N-terminal region (ARP90634_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "FKBP4 Antibody - N-terminal region (ARP90634_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "FKBP4 Antibody - N-terminal region (ARP90634_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FKBP4 Antibody - N-terminal region (ARP90634_P050)"?

    This target may also be called "p59, FKBP5, FKBP-4, FKBP-5, FKBP52, FKPB52, FKBP-52, AL022792, AW208983" in publications.

  5. What is the shipping cost for "FKBP4 Antibody - N-terminal region (ARP90634_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FKBP4 Antibody - N-terminal region (ARP90634_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FKBP4 Antibody - N-terminal region (ARP90634_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FKBP4 Antibody - N-terminal region (ARP90634_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FKBP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FKBP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FKBP4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FKBP4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FKBP4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FKBP4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FKBP4 Antibody - N-terminal region (ARP90634_P050)
Your Rating