FKBP4 Antibody - C-terminal region (ARP88140_P050)

Catalog No: ARP88140_P050

Host: Rabbit
Target Name: FKBP4
Sample Tissue: Human U937 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FKBP4 (ARP88140_P050) antibody is Catalog # AAP88140

Target Info

• Gene Symbol: FKBP4
• Gene Full Name: FK506 binding protein 4
• Alias Symbols: HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase
• NCBI Gene Id: 2288
• Protein Name: Peptidyl-prolyl cis-trans isomerase FKBP4
• Description of Target: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. The human genome contains several non-transcribed pseudogenes similar to this gene.
• Uniprot ID: Q02790
• Protein Accession #: NP_002005.1
• Nucleotide Accession #: NM_002014.3
• Protein Size (# AA): 459
• Molecular Weight: 50 kDa