FKBP2 Antibody - N-terminal region (ARP58465_P050)

Catalog No: ARP58465_P050

WB Suggested Anti-FKBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateFKBP2 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FKBP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FKBP2 (ARP58465_P050) antibody is Catalog # AAP58465 (Previous Catalog # AAPP34740)
• Sample Type Confirmation:

  FKBP2 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Lim,J., (2006) Cell 125 (4), 801-814

Target Info

• Gene Symbol: FKBP2
• Gene Full Name: FK506 binding protein 2, 13kDa
• Alias Symbols: FKBP13, PPIase, FKBP-13
• NCBI Gene Id: 2286
• Protein Name: Peptidyl-prolyl cis-trans isomerase FKBP2
• Description of Target: FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. This gene has two alternatively spliced transcript variants that encode the same isoform. Multiple polyadenylation sites have been described for this gene, but the full length nature of this gene has not been determined.
• Uniprot ID: P26885
• Protein Accession #: NP_004461
• Nucleotide Accession #: NM_004470
• Protein Size (# AA): 142
• Molecular Weight: 16kDa
• Protein Interactions: UBQLN1; RAB3C; VAMP2; RAB6A; UBC; BARD1; UBQLN4; PTGES3; RAP2A; MAPK3; ARFGEF1; EPB41L2; BAG6; EPB41; C1QC; ARFGEF2; CDKN2A;