Loading...
Catalog No: ARP58465_P050
Price: $0.00
SKU
ARP58465_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FKBP2 (ARP58465_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FKBP2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV
Concentration0.5 mg/ml
Blocking PeptideFor anti-FKBP2 (ARP58465_P050) antibody is Catalog # AAP58465 (Previous Catalog # AAPP34740)
Sample Type Confirmation

FKBP2 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceLim,J., (2006) Cell 125 (4), 801-814
Gene SymbolFKBP2
Gene Full NameFK506 binding protein 2, 13kDa
Alias SymbolsFKBP13, PPIase, FKBP-13
NCBI Gene Id2286
Protein NamePeptidyl-prolyl cis-trans isomerase FKBP2
Description of TargetFKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. This gene has two alternatively spliced transcript variants that encode the same isoform. Multiple polyadenylation sites have been described for this gene, but the full length nature of this gene has not been determined.
Uniprot IDP26885
Protein Accession #NP_004461
Nucleotide Accession #NM_004470
Protein Size (# AA)142
Molecular Weight16kDa
Protein InteractionsUBQLN1; RAB3C; VAMP2; RAB6A; UBC; BARD1; UBQLN4; PTGES3; RAP2A; MAPK3; ARFGEF1; EPB41L2; BAG6; EPB41; C1QC; ARFGEF2; CDKN2A;
  1. What is the species homology for "FKBP2 Antibody - N-terminal region (ARP58465_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "FKBP2 Antibody - N-terminal region (ARP58465_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FKBP2 Antibody - N-terminal region (ARP58465_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FKBP2 Antibody - N-terminal region (ARP58465_P050)"?

    This target may also be called "FKBP13, PPIase, FKBP-13" in publications.

  5. What is the shipping cost for "FKBP2 Antibody - N-terminal region (ARP58465_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FKBP2 Antibody - N-terminal region (ARP58465_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FKBP2 Antibody - N-terminal region (ARP58465_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FKBP2 Antibody - N-terminal region (ARP58465_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FKBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FKBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FKBP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FKBP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FKBP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FKBP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FKBP2 Antibody - N-terminal region (ARP58465_P050)
Your Rating