FKBP1B Antibody - middle region (ARP85682_P050)

Catalog No: ARP85682_P050

Host: Rabbit
Target Name: FKBP1B
Sample Tissue: Human LN18 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FKBP1B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FKBP1B (ARP85682_P050) antibody is Catalog # AAP85682

Target Info

• Gene Symbol: FKBP1B
• Gene Full Name: FK506 binding protein 1B
• Alias Symbols: OTK4, FKBP1L, PKBP1L, PPIase, FKBP12.6
• NCBI Gene Id: 2281
• Protein Name: peptidyl-prolyl cis-trans isomerase FKBP1B
• Description of Target: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
• Uniprot ID: P68106
• Protein Accession #: NP_004107.1
• Nucleotide Accession #: NM_004116.3
• Protein Size (# AA): 108
• Molecular Weight: 11 kDa