Catalog No: ARP53493_P050
Price: $0.00
SKU
ARP53493_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FITM1 Antibody - middle region (ARP53493_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-FITM1 (ARP53493_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LOC161247
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH
Concentration0.5 mg/ml
Blocking PeptideFor anti-FITM1 (ARP53493_P050) antibody is Catalog # AAP53493 (Previous Catalog # AAPP38306)
ReferenceKadereit,B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 94-99
Gene SymbolFITM1
Gene Full NameFat storage-inducing transmembrane protein 1
Alias SymbolsFIT1
NCBI Gene Id161247
Protein NameFat storage-inducing transmembrane protein 1
Description of TargetThe specific function of this protein remains unknown.FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 BX347190.2 448-541 c 95-825 BI114004.1 1-731 826-928 BQ574746.1 1-103 c
Uniprot IDA5D6W6
Protein Accession #NP_981947
Nucleotide Accession #NM_203402
Protein Size (# AA)292
Molecular Weight32kDa
Protein InteractionsAPP;
  1. What is the species homology for "FITM1 Antibody - middle region (ARP53493_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "FITM1 Antibody - middle region (ARP53493_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FITM1 Antibody - middle region (ARP53493_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FITM1 Antibody - middle region (ARP53493_P050)"?

    This target may also be called "FIT1" in publications.

  5. What is the shipping cost for "FITM1 Antibody - middle region (ARP53493_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FITM1 Antibody - middle region (ARP53493_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FITM1 Antibody - middle region (ARP53493_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "32kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FITM1 Antibody - middle region (ARP53493_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FITM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FITM1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FITM1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FITM1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FITM1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FITM1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FITM1 Antibody - middle region (ARP53493_P050)
Your Rating
We found other products you might like!