FIMH Recombinant Protein (Escherichia coli) (OPCA02951)

Catalog No: OPCA02951

Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.

fimH Recombinant Protein (Escherichia coli) (OPCA02951) in SDS-PAGE showing the molecular weight of approximately 31.1 kDa.

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Lyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose (pH 8.0)
• Host: Escherichia coli
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
  Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length of Mature Protein: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
• Source: Yeast
• Protein Range: 22-300 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.Hung C.S., Bouckaert J., Hung D., Pinkner J., Widberg C., DeFusco A., Auguste C.G., Strouse R., Langermann S., Waksman G., Hultgren S.J.Mol. Microbiol. 44:903-915(2002)
• Gene Symbol: fimH
• Gene Full Name: type 1 fimbriae D-mannose specific adhesin
• Alias Symbols: b4320;ECK4311;pilE;Protein FimH;type 1 fimbriae D-mannose specific adhesin.
• NCBI Gene Id: 948847
• Protein Name: Type 1 fimbrin D-mannose specific adhesin
• Description of Target: Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
• Uniprot ID: P08191
• Protein Accession #: NP_418740.1
  
• Nucleotide Accession #: NC_000913.3
• Protein Size (# AA): Recombinant
• Molecular Weight: 31.1 kDa