SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37173_P050
Price: $0.00
SKU
ARP37173_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Figla (ARP37173_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Figla
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceMouse: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS
Concentration0.5 mg/ml
Blocking PeptideFor anti-Figla (ARP37173_P050) antibody is Catalog # AAP37173
Gene SymbolFigla
Gene Full Namefolliculogenesis specific basic helix-loop-helix
Alias SymbolsbHLHc, bHLHc8, FIGalpha
NCBI Gene Id26910
Protein NameFactor in the germline alpha
Description of TargetFigla is a germ-line specific transcription factor implicated in postnatal oocyte-specific gene expression. It plays a key regulatory role in the expression of multiple oocyte-specific genes, including those that initiate folliculogenesis and those that encode the zona pellucida (ZP1, ZP2 and ZP3) required for fertilization and early embryonic survival. It is essential for oocytes to survive and form primordial follicles. The persistence of FIGLA in adult females suggests that it may regulate additional pathways that are essential for normal ovarian development. Figla binds to the E-box (5'-CANNTG-3') of the ZPs (ZP1, ZP2, ZP3) promoters.
Uniprot IDO55208
Protein Accession #NP_036143
Nucleotide Accession #NM_012013
Protein Size (# AA)194
Molecular Weight21kDa
  1. What is the species homology for "Figla Antibody - C-terminal region (ARP37173_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse, Rat".

  2. How long will it take to receive "Figla Antibody - C-terminal region (ARP37173_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Figla Antibody - C-terminal region (ARP37173_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Figla Antibody - C-terminal region (ARP37173_P050)"?

    This target may also be called "bHLHc, bHLHc8, FIGalpha" in publications.

  5. What is the shipping cost for "Figla Antibody - C-terminal region (ARP37173_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Figla Antibody - C-terminal region (ARP37173_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Figla Antibody - C-terminal region (ARP37173_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Figla Antibody - C-terminal region (ARP37173_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FIGLA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FIGLA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FIGLA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FIGLA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FIGLA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FIGLA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Figla Antibody - C-terminal region (ARP37173_P050)
Your Rating