Catalog No: OPCA208462
Price: $0.00
SKU
OPCA208462
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ FHL2 Recombinant Protein (Human) (OPCA208462)
Datasheets/Manuals | Printable datasheet for OPCA208462 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 1-279 |
Gene Full Name | four and a half LIM domains 2 |
---|---|
Alias Symbols | DRAL, AAG11, FHL-2, SLIM3, SLIM-3 |
NCBI Gene Id | 2274 |
Protein Name | four and a half LIM domains protein 2 |
Description of Target | This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is th |
Uniprot ID | Q14192 |
Protein Accession # | NP_001034581.1 |
Nucleotide Accession # | NM_001039492.2 |
Protein Size (# AA) | 279 |
Write Your Own Review